Slepian-Wolf Coding over Cooperative Networks Mohammad Hossein Yassaee, Mohammad Reza Aref Information Systems and Security Lab (ISSL) EE Department, Sharif University of Technology, Tehran, Iran E-mail: [email protected], [email protected] Abstract—We present sufficient conditions for multicasting a ratesforMultipleAccessRelayChannelandmultisource,mul- set of correlated sources over cooperative networks. We propose tirelay and multidestination networks, respectively. Compress jointsource-Wyner-Zivencoding/sliding-windowdecoding scheme, and Forward (CF) strategy was generalized to relay networks 9 in which each receiver considers an ordered partition of other with one source and one destination by severalauthorsin [8], 0 nodes. Subject to this scheme, we obtain a set of feasibility [9]. Also, Avestimehr, et.al in [10], [11] proposed a quantize- 0 constraintsforeachorderedpartition.Weconsolidatetheresults map scheme for Gaussian relay networks with multicast de- 2 ofdifferentorderedpartitionsbyutilizingaresultofgeometrical mands which achieves the cut-set bound within a constant approach to obtain the sufficient conditions. We observe that n numberofbits.TheirschemeisbasedonWyner-Zivencoding these sufficient conditions are indeed necessary conditions for a Arefnetworks.Asaconsequenceofthemainresult,weobtainan at relays and a distinguishability argument at receivers. J achievablerateregionfornetworkswithmulticastdemands.Also, In this paper, we propose a joint Source-Wyner-Ziv encod- 5 wededuceanachievabilityresultfortwo-wayrelaynetworks,in ing/sliding window decoding scheme for Slepian-Wolf cod- 1 which two nodes want to communicate over a relay network. ing over cooperative networks. Our scheme results in the operational separation between source and channel coding. T] I. INTRODUCTION In addition, this scheme does not depend on the graph of I We consider the problem of reliable transmission of dis- networks, so the result can easily be applied to any arbitrary s. cretememorylesscorrelatedsources(DMCS)overcooperative network (In general for multi-user networks which are char- c networks in which each node can simultaneously encode a acterized by a conditional probability distribution, it is not [ message, relay the messages of other nodes and decode the always possible to describe networkswith a graph).We show 1 messages. The main goal of this paper is to find sufficient thatthesufficientconditions,arealsonecessaryconditionsfor v conditions to the following problem: the Slepian-Wolf coding over arbitrary Aref networks. As an 8 Given a set of sources U ={U :a ∈A} observed at another consequence of the proposed scheme, we obtain an 1 nodes A = {a ,··· ,a } ⊆AV (V a=j {1j,··· ,N} is the set achievable rate region based on CF strategy. Moreover, one 1 M 2 of nodes in the network) respectively and a set of receivers can easily check that our achievable rate for relay networks 2 at nodes B = {b ,··· ,b } ⊆ V which is not necessarily subsumes the achievable rates 1. disjoint from A, w1hat conKditions must be satisfied to enable obtained for deterministic and Gaussian relay networks 0 us to reliably multicast U to all nodes in B? in [11]. Finally, we apply the main result and prove an A 9 In addition to this problem,we are interested in the special achievability theorem for the two-way relay network, which 0 case of reliable transmission of independent sources (mes- is consisted of two transmitters communicating over a relay v: sages) over cooperative networks with multicast demands. networks. i In particular, we consider the problem of finding a feasible X rate region for two-way relay networks as a special case of II. PRELIMINARIES AND DEFINITIONS r cooperative networks with two transmitters and two receivers a We denote discrete random variables with capital letters, with multicast demands. e.g., X, Y, and their realizations with lower case letters x, y. The problem of Slepian-Wolf coding over multi-user chan- A random variable X takes values in a set X. We use |X| to nels has been considered for some special networks. In denote the cardinality of a finite discrete set X, and p (x) [1], Tuncel obtained a necessary and sufficient condition for X to denote the probability density function (p.d.f.) of X on X. multicasting a source over a broadcast channel with side For brevity we may omit the subscript X when it is obvious information at each receiver. He proposed a joint source- fromthecontext.We denotevectorswithboldfaceletters,e.g. channel coding scheme that achieves operational separation x, y. In addition,we let Xi =(X ,··· ,X ). We use Tn(X) betweensourcecodingandchannelcoding.In[2],anecessary 1 i ǫ to denote the set of ǫ-strongly typical sequences of length n, and sufficient condition for multicasting a set of correlated w.r.t.densityp (x)onX.Further,weuseTn(Y|x)todenote sources over acyclic Aref networks [3] has been derived. X ǫ thesetofalln-sequencey suchthat(x,y) arejointlytypical, Also the problem of multicasting of correlated sources over w.r.t. p (x,y). We denote the vectors in the jth block by a networks was studied in network coding literature [4], [5]. XY subscript[j]. Fora givensetS, we defineX ={X :i∈S} Finding the achievable rate region of multi-relay networks S i and R = R . isoneoftheinterestingproblemsinShannontheory.Basedon S i∈S i DecodeandForwardstrategy,[6]and[7]proposedachievable We conPsider the problem of reliable multicasting of the DMCS U to the subset B of nodes, where trans- A mission is over discrete memoryless cooperative network ThisworkwaspartiallysupportedbyIranian-NSFundergrantNo.84.5193- 2006 p(y1,··· ,yN|x1,··· ,xN) with input alphabet and output 1 alphabetXv andYv ateachnodev ∈V,respectively.Aformal H(US|UA\S) = mH(USm|UAm\S) definition of the problem is given below. 1 Definition 1: WesaythatthesetofDMCS,U canreliably = (I(Um;Yn|Um )+H(Um|Um Yn)) A m S bi A\S S A\S bi be transmitted over discrete memoryless cooperative network 1 to all nodes in B, if there exist positive integers (m,n) and a ≤ mI(USm;YWnC|UAm\S)+ǫ sequence of encoding functions (=a) 1H(Yn |Um )+ǫ f(m) :Um×Yt−1 →X for t=1,··· ,n m WC A\S v,t v v v (=b) 1 n H(Y |Um Yi−1X )+ǫ atallnodesv ∈V,wherefornon-sourcenodeswe letUv =∅ mX WC,i A\S WC WC,i and a set of decoding functions defined at each node b ; i=1 i n 1 g(m,n) :Um×Yn →Um ≤ mXH(YWC,i|XWC,i)+ǫ bi bi bi A i=1 fsourchaltlhbaitt∈heBpraosbmab,inlitygoPtro(ginb(imfin,nit)y(Uwbmiit,hYbmnni)g6=oeUsAto)voannei.shes (≤=c) mnnHH((YYWC,Q||XXWC,Q,)Q+)ǫ+ǫ m WC,Q WC,Q III. SUMMARY OFMAIN RESULTS (d) → H(Y |X ) (6) In this section, we provide a summary of our main results. WC WC The following theorem is the main result of the paper. where (a) follows because Yn is a function of Um, (b) Theorem 1: ThesetofDMCSUA canreliablybetransmit- follows from definition 1, (c)WiCs obtained by introduAcing a ted over cooperative network, if there exist auxiliary random standard time-sharing random variable Q and (d) follows, by variables YˆV such that for each S ⊆A, we have allowingm,n→∞andsettingYV =YV,Q andXV =XV,Q. H(US|UA\S)<bim∈Bin\S V⊇mWin⊇S:[I(XW;YbiYˆWC\{bi}|XWC) netNwoowrk,wleinecaornsdideteerrmtwinoistsicpecfiinailtec-fiaseelds onfetwaordketearnmdinAisrteicf bi∈WC network. For linear deterministic finite-field network, it is −I(YW;YˆW|XVYbiYˆWC\{bi})] (1) shown in [11] that the product uniform distribution achieves simultaneously the maximum of RHS of (4) for all W ⊆ V. where the joint p.d.f. of random variables factors as InArefnetwork,itisshownthattheRHSof(4)onlydepends p(uA)[ p(xv)p(yˆv|xv,yv)]p(yV|xV). (2) onthemarginaldistributions,i.e.,p(xv). Hence,lemma1and vY∈V (3) together imply the following theorem: Proof: We sketch the proof in the next section. Theorem 2: A set of correlated sources can reliably be Remark 1: Theconstraint(1) separatessourcecodingfrom multicast over a deterministic network, if for each S ⊆A the channel coding in the operational separation sense [1]. The constraint (3) is satisfied. Moreover, this constraint is indeed LHS of (1) represents the rate of Slepian-Wolf coding, while necessary for two classes of deterministic networks, namely the RHS of (1) provides an achievable flow through a cut linear deterministic finite-field network and Aref network. Λ=(W,WC) over the cooperative network. Now, we concentrate on finding an achievable rate region In the rest of this section, we consider some consequences for cooperative networks. Let R be the rate of message of of Theorem 1. First, assume that each channel output is a v the node v. The next theorem gives an achievable rate region deterministicfunctionofallchannelinputs,i.e.,y =g (x ). v v V for cooperative network. Setting Yˆ =Y in Theorem 1, we conclude that the reliable v v Theorem 3: An N-tuple (R ,R ,··· ,R ) is contained in transmission of DMCS over deterministic network is feasible 1 2 N the achievable rate region of cooperative network with mul- if there exists a product distribution p(x ) such that: v v ticast demands at each node bi ∈ B, if for each S ⊆ V the H(U |U )< min minQH(Y |X ) (3) following constraint holds: S A\S WC WC bi∈B\S Vb⊇i∈WW⊇CS: R < min min I(X ;Y Yˆ |X )− Itrnanthsmeifsosilolonwoinfgcolerrmelmatae,dwseouprcroevsidoevear dceotnevremrsineisftoicr creoloiapbelre- S bi∈B\S Vb⊇i∈WW⊇CS:(cid:2) W bi WC\{bi} WC ative network. I(YW;YˆW|XVYbiYˆWC\{bi}) + (7) oveLremamdaet1er:mIifniastsiectnoeftwDoMrkC,SthUenAtchaenrereelxiaisbtlsyabejominutltpi.cda.sft. where [x]+ = max{x,0} and the joint p.d.f. of (xV,(cid:3)yV,yˆV) factors as p(x )p(yˆ |x ,y )]p(y |x ). p(xV) such that v∈V v v v v V V Proof:QLetT bethelargestsubsetofV suchthattheRHS of (1) is nonnegativesubject to each S ⊆T (Note that if two H(US|UA\S)< min min H(YWC|XWC) (4) subsets T1,T2 have this property, then T1 ∪T2 also has this bi∈B\S Vb⊇i∈WW⊇CS: property, so such T is unique). Now let A = T in Theorem Proof: By Fano’s inequality, we have: 1. Assume U (v ∈A) have uniform distribution over the set v 1 ∀S ⊆V,b ∈B\S : H(Um|Um Yn)≤ǫ (5) Uv and be mutually independent. Substituting Rv = H(Uv) i m S A\S bi in Theorem 1 yields that U can reliably be multicast, if (7) T For each (W,bi) such that S ⊆ W ⊆ V and bi ∈ WC, we holds. Hence (R1,··· ,RN) is achievable (Note that Rv =0 have: for each node v ∈TC). Remark 2: Consider a relay network with node 1 as a Codebook generation at node v: Fix δ > 0 such that transmitter which has no channel output, i.e., Y1 = ∅, N −2 |Tǫn(Uv)|<2n(H(Uv)+δ). To eachelementofTǫn(Uv), assign relay nodes {2,··· ,N − 1} and node N as a destination a number wv ∈[2,2n(H(Uv)+δ)] using a one-to-one mapping. which has no channel input, i.e., X = ∅. Substituting Moreover, we assign one to each non-typical sequence u . N v R = ··· = R = 0 in Theorem 3 gives the following We denote the result by u (w ). For channel coding repeat 2 N v v achievable rate (R ) for relay network. independently the following procedure V times. We denote CF the resulting kth codebook by C (k). v RCF = min I(XS;YˆSC\{N}YN|XSC)− Choose2n(H(Uv)+I(Yv;Yˆv|Xv)+2δ) codewordsxv(wv,zv),each 1∈SS,⊆NV∈:SC (cid:2) drawn uniformly and independently from the set Tǫn(Xv) I(YS;YˆS|XVYNYˆSC\{N}) + (8) where zv ∈ [1,2n(I(Yv;Yˆv|Xv)+δ)]. For Wyner-Ziv cod- (cid:3) ing, for each xv(wv,zv) create 2n(H(Uv)+δ) lists Lv(wv′) It can be shown that this rate subsumes the achievable rate of with 2n(I(Yv;Yˆv|Xv)+δ) codewords each drawn uniformly [9, Theorem 3]. and independently from the set Tn(Yˆ |x ) where w′ ∈ Remark 3: Consider a two-way relay network with nodes ǫ v v v 1 and N as two transmitters, each demanding the message [1,2n(H(Uv)+δ)]. We denote the codewords of Lv(wv′) by of the other node, and N −2 relay nodes {2,··· ,N −1}. yˆv(wv′,zv′|xv) where zv′ ∈[1,2n(I(Yv;Yˆv|Xv)+δ)]. Substituting R = ··· = R = 0 and Yˆ = Yˆ = ∅ Encoding at node v: Divide the nB-length source stream 2 N−1 1 N unB into B vectors (u : 1 ≤ j ≤ B) where u = in Theorem 3 gives the following achievable rate region for v v,[j] v,[j] (u ,··· ,u ). We say that channel encoder re- two-way relay network. v,(j−1)n+1 v,jn ceives m = (m ,··· ,m ), if for 1 ≤ j ≤ B, u k =1,N : Rk = k∈SSm,⊆k¯iV∈n:SC (cid:2)I(XS;YˆSC\{k¯}Yk¯|XSC)− winaBs a+ss2igVvne−d3tobmlov,cv[k,1[]js]w∈h[e1r,e2vinn,([BHb]l(oUcvk)+bδ,)]w.eEnucseodtihnegcpoedrefbovorm,o[jks] I(YS\{k};YˆS\{k}|XVYk¯YˆSC\{k¯}) + (9) Cv(b mod V). For 1≤b≤B+2V −3, define: (cid:3) where ¯1=N and N¯ =1. m ,V ≤b≤B+V −1 Remark 4: Suppose the channel output of relay nodes be w = v,[b−V+1] v,[b] (cid:26) 1 ,otherwise a function of channel inputs, i.e., ∀v ∈ V\{1,N} : y = v g (x ).Setyˆ =y in(8),wededucethatthecut-setboundis v V v v In block 1, a default codeword, x (1,1) is transmitted. In achievablefor productdistribution.This is a generalizationof v block b > 1, by knowing z from Wyner-Ziv coding at [11, Theorem4.2.3]whichstates thatcut-setboundis achiev- v,[b−1] the end of block b−1 (described below), node v transmits able under product distribution for deterministic network. x (w ,z ). Remark 5: In [10], [11], authorsshow that by quantization v v,[b] v,[b−1] at noise level, Gaussian relay network achieves the cut-set Wyner-Ziv coding: At the end of block b, node v knows bound within 5|V| bits. It can be shown using [11, Appendix (xv,[b−1],yv,[b−1]) and wv,[b] (note that mv is available non- A.5]andquantizationatthenoiselevelthattheachievablerate causally at node v), considers the list Lv(wv,[b]) and declares ofRemark2achievesthecut-setboundwithin 3|V| −1bits. that zv,[b−1] =zv is received if zv is the smallest index such A similar result holds for two-way Gaussian r(cid:4)el2ay n(cid:5)etwork. that (yˆv,[b−1](wv,[b],zv|xv,[b−1]),xv,[b−1],yv,[b−1]) are typi- cal. Since Lv(wv,[b]) contains 2n(I(Yv;Yˆv|Xv)+δ) codewords, IV. PROOF OF THEOREM1 such z exists with high probability (See Table I which v We prove Theorem 1 in three steps. In subsection IV-A, describes encoding for network with four nodes). weproposeajointsource-Wyner-Zivencoding/slidingwindow Decoding at node bi: Let C(bi) = [L1,··· ,Lℓ] decoding scheme. For encoding, each node first compresses be an ordered partition of the set V−bi = V\{bi}. its observation using Wyner-Ziv coding, then jointly maps its We propose a sliding window decoding with respect to source sequence and compressed observation to a codeword. C(bi). Define sv,[b] = (wv,[b],zv,[b−1]). Suppose that Inthedecodingpartofthescheme,eachreceiverconsidersan (sL1,[b−1],sL2,[b−2],··· ,sLℓ,[b−ℓ]) were decoded correctly ordered partition of other nodes to decode jointly the sources at the end of block b − 1. The node bi, declares that andthecompressedobservationsofothernodes.Weprovidea (sL1,[b],··· ,sLℓ,[b−ℓ+1]) = (sˆL1,··· ,sˆLℓ) was sent, if for each 1≤k ≤ℓ+1, set of sufficientconditionsfor reliable transmission of DMCS over cooperative networks. In subsection IV-B, by applying a result of geometrical approach [9], we unify the results if 1≤b−k+1: x (sˆ ),yˆ (sˆ |x ) of subsection IV-A under different ordered partitions. The “ Lk Lk Lk−1 Lk−1 Lk−1,[b−k+1] result of this section, yields Theorem 1 with an additional ,x ,yˆ ,y ,x ∈Tn Lk,[b−k+1] Lk−1,[b−k+1] bi,[b−k+1] bi,[b−k+1]” ǫ set of constraints corresponding to reliable decoding of the if V ≤b−k+1≤V +B: (u (wˆ ), compressed observations of other nodes. In subsection IV-C, Lk Lk u (w ),u )∈Tn (10) we show that without loss of generality, we can neglect these Lk Lk,[b−k+1] bi,[b−k+1] ǫ constraints. This completes the proof. whereLk =∪k−1L ,L =L =∅ands =(w ,z ). A. Joint Source-Wyner-Ziv coding/Sliding Window Decoding Note that at thej=e1ndjof b0lock Bℓ++1 V +ℓ−2L,kthe veLctkor Lmk A We transmit m = nB length source over cooperative is decoded. Since each (uv,[j] :v ∈A,1≤j ≤ B) is typical network in B +2V −3 blocks of length n where V is the with high probability, we find the source sequence unB with A cardinality of V. small probability of error. TABLEI ENCODINGSCHEMEFORMULTICASTOVERNETWORKWITHV ={1,2,3,4}(THEENCODINGSCHEMEOFOTHERNODESISSIMILAR) Node Block1 Block2 Block3 Block4 Block5 Block6 Block7 u1(m1[1]) u1(m1[2]) 1 x1(1,1) x1(1,z1[1]) x1(1,z1[2]) x1(m1[1],z1[3]) x1(m1[2],z1[4]) x1(1,z1[5]) x1(1,z1[6]) yˆ1(1,z1[1]|x1[1]) yˆ1(1,z1[2]|x1[2]) yˆ1(m1[1],z1[3]|x1[3]) yˆ1(m1[2],z1[4]|x1[4]) yˆ1(1,z1[5]|x1[5]) yˆ1(1,z1[6]|x1[6]) yˆ1(1,z1[7]|x1[7]) u2(m2[1]) u2(m2[2]) 2 x2(1,1) x2(1,z2[1]) x2(1,z2[2]) x2(m2[1],z2[3]) x2(m2[2],z2[4]) x2(1,z2[5]) x2(1,z2[6]) yˆ2(1,z2[1]|x2[1]) yˆ2(1,z2[2]|x2[2]) yˆ2(m2[1],z2[3]|x2[3]) yˆ2(m2[2],z2[4]|x2[4]) yˆ2(1,z2[5]|x2[5]) yˆ2(1,z2[6]|x2[6]) yˆ2(1,z2[7]|x2[7]) Error Probability Analysis: We bound the probability of the proposed encoding scheme, to prove lemma 2. But in error in (10) as follows: general, since the ordered partitions corresponding to each receiver for reliable decoding are different, it is not possible P = P ∃(sˆ ,··· ,sˆ )∈ to obtain a same offset encoding scheme for all destinations. e L1 Lℓ ∅6=SX⊆V−biWX⊆S (cid:16) TanhyisinmfaokrmesatciloenarinwhthyetfiherstenVco−di1ngbslocchkesm.e does not transmit NS(1W) ×···×NS(ℓW) :(sˆL1,··· ,sˆLℓ) satisfies (10) (11) Remark 7: Intheerroranalysis,weonlycomputethe error (cid:17) corresponding to block V +ℓ−1 ≤ b ≤ V +B, for which where N(k) is the following set: all ℓ consecutive blocks (b−ℓ+1,··· ,b) contain sources’ S,W information.However,itcanbeshownthattheconstraintsare NS(k,W) ={sLk :∀t∈Sk and t′ ∈Wk,st 6=st,[b−k+1] otobtbalioncekdsfrtohmatedroronroatnahlayvseisionffoortmheartibolnocakbsowuthtihchecsoorurrecsepso,nids wt′ 6=wt′,[b−k+1]andsSkC =sSkC,[b−k+1],wWkC =wWkC,[b−k+1]} dominated by (14). where S = S ∩L , W = W ∩L , SC = SC ∩L and k k k k k k WC =WC ∩L . B. Unified Sufficient Condition k k The probability inside the summation (11) represents the In this subsection, we provide a set of sufficient conditions probability of error corresponding to incorrect decoding of thatdonotdependonaspecifiedorderedpartition.Todothis, sS such that wS\W was decoded correctly. Denote this prob- weneedthefollowinglemmawhichwaspartiallystatedin[9] ability by Pe,S,W. We compute it in equation (12) shown asa resultofgeometricalpropertiesofachievablerateregions at the top of the next page, in which (a) follows, because obtained from sequential decoding: ℓ ≤ V and the codebook generation of any V consecutive Lemma 3: LetF bethecollectionofallorderedpartitions Z blocksareindependent.Moreover,the codebookgenerationis of a set Z. For each C=[L ,··· ,L ]∈F , define 1 ℓ Z independentof source stream and the sourcesare i.i.d., so the source sequences are generated independently in consecutive RC ={(R1,··· ,R|Z|)∈R|Z| :∀S ⊆Z blocks.(b)followsfromthefactthatx (s )andyˆ (s |x )were ℓ+1 Tdrnaw(Yˆn|uxni)f,orrmeslpyeacntidveilnyd.ependentlyfrotmtthesetstTǫnt(Xtt)and RS ≥Xk=1H(Y˜Sk−1X˜Sk|X˜SkCY˜SkC−1X˜LkY˜Lk−1Z˜)} (15) ǫ t t Note that each (z : t ∈ S) and (w : t′ ∈ W) take t t′ then for any joint distribution p(x˜ ,y˜ ,z˜), the following 2n(I(Yt;Yˆt|Xt)+δ) and 2n(H(Ut′)+δ) values, respectively. This identity holds: Z Z fact, (11) and (12) together imply that for reliable decoding, for each (S,W) such that W ⊆S, we must have: RC ={(R1,··· ,R|Z|)∈R|Z| :∀S ⊆Z ℓ+1 C[∈FZ XI(Yt;Yˆt|Xt)≤XH(XtYˆt)−X`H(UWk|UWkCULkUbi) RS ≥H(Y˜SX˜S|X˜SCY˜SCZ˜)} (16) t∈S t∈S k=1 Proof: The proof is omitted due to the space limitation. +H(XSkYˆSk−1|XSkCYˆSkC−1XLkYˆLk−1YbiXbi)´ (13) Now consider the RHS of (14). Since the random variables NotethattheRHSof(13)takestheminimumvalueforW = (U ) and (X ,Yˆ ,Y ) are independent, the RHS of (14) A V V V S. Hence we proved the following lemma: can be expressed in the form of (15) with Z = V , Lemma 2: The set of DMCS UA can reliably be multicast X˜ = (X ,U ), Y˜ = Yˆ and Z˜ = (Y ,X ,U ). For e−abcih overcooperativenetworkto the subsetB ofnodes,if foreach t t t t t bi bi bi bi ∈B,thereisanorderedpartitionC(bi) ofV\{bi}suchthat v ∈V, define Rv =H(XvYˆv)−I(Yv;Yˆv|Xv) and let for each S ⊆V , the following constraint holds: −bi ℓ+1 R(bi) =(R1,··· ,Rbi−1,Rbi+1,··· ,RV) XH(XtYˆt)−I(Yt;Yˆt|Xt)≥X`H(USk|USkCULkUbi) Lemma 2 states that UA can be multicast over the network, t∈S +H(XSkYˆSk−1|XSkCYˆSk=kC−11XLkYˆLk−1YbiXbi)´ (14) RifCfo(bri)e.aAchppblyiitnhgerleememxiast3s,Cw(ebic)on∈clFudVe−tbhiastuscuhchthCat(biR)(ebxi)is∈ts iff : whererandomvariables(x ,y ,yˆ )aredistributedaccording V V V to (2). ∀b ∈B, S ⊆V : Remark 6: If there is only one destination, one can use i −bi offset encoding scheme [6], [7] which has less delay than RS(bi) ≥H(YˆSXS|XSCYˆSCYbiXbi)+H(US|USCUbi) (17) ℓ+1 P (=a) P (x (sˆ ),yˆ (sˆ |x ),x ,yˆ ,y ,x )∈Tn e,S,W Lk Lk Lk−1 Lk−1 Lk−1,[b−k+1] Lk,[b−k+1] Lk−1,[b−k+1] bi,[b−k+1] bi,[b−k+1] ǫ (sˆL1X,···,sˆLℓ) kY=1h (cid:0) (cid:1) ∈NS(1W) ×···×NS(ℓW) ×P (u (wˆ ),u (w ),u )∈Tn Lk Lk Lk Lk,[b−k+1] bi,[b−k+1] ǫ (cid:0) (cid:1)i (=b) ℓ |N(p)|ℓ+1 |Tǫn(XSk,YˆSk−1|xSkC,yˆSkC−1,xLk,yˆLk−1,ybi,xbi)| × |Tǫn(UWk|uWkCuLkubi)| (12) pY=1 SW kY=1(cid:0) t∈Sk|Tǫn(Xt)| t′∈Sk−1|Tǫn(Yˆt′|xt′)| t∈Wk|Tǫn(Ut)| (cid:1) Q Q Q Note that we can write (17) in the following form which V. CONCLUSIONS will be used in the subsection IV-C to complete the proof This paper obtained sufficient conditions for multicasting of Theorem 1: a set of correlated sources over a cooperative network. The ∀S ⊆A\{bi}: sufficient conditions resulted in an operational separation H(US|UA\S)≤ Wm⊇inS RW(bi)−H(YˆWXW|XWCYˆWC\{bi}Ybi) between source and channel coding. It was shown that these bi∈WC sufficient conditions are also necessary for the Aref network. C.∀SFi⊆naAl RCe\s{ublit}:RS(bi)−H(YˆSXS|XSCYˆSC\{bi}Ybi)≥0 (18) Anestwaosrkpewciaasldcearsiev,edananadchtiheevarbesleulrtawteasresgpieocnififeodr tcooothpeerraetliavye networkandtwo-wayrelaynetwork.Moreover,itwaspartially This subsection claims that for each b , we can reduce the i shownthattheseachievablerateregionssubsumesomerecent constraints of (18) to the first term of it. We prove this by achievable rate regions which were derived using Wyner-Ziv induction on |V |. If |V | = 1, there is nothing to prove. −bi −bi coding. Now suppose the induction assumption is true for all k < |V |. For each Z ⊆ V which contains b and each S ⊆ −bi i VI. ACKNOWLEDGEMENT Z\{b }, let i The authors wish to thank M. B. Iraji and B. Akhbari for hZ(bi)(S)=RS(bi)−H(YˆSXS|XZ\SYˆZ\(S∪{bi})Ybi) comments that improved the presentation. Assume there is a subset T of AC\{bi} such thath(Vbi)(T)< REFERENCES 0. For each W ⊆V observe that, −bi [1] E.Tuncel. “Slepian-Wolfcodingoverbroadcastchannels”. IEEETrans. hV(bi)(W∪T)=hV(bi)(T)+RW(bi\)T− Inform.Theory,52(4):1469–1482 ,2006. H(YˆWXW|XWC\TYˆWC\(T∪{bi})Ybi) [2] oSv.eBr.AKroerfadnaetawnodrkDs”..VainsuPderovacn..IE“EBEroaIndtc.asStymanpd.SInlefopriamn.-WThoelofrmyu(lItSicITas)t, <RW(bi\)T −H(YˆWXW|XWC\TYˆWC\(T∪{bi})Ybi) [3] 2M0.08R,.pAp.r1e6f.56“-I1n6fo6r0m.ation flow in relay networks”. Ph.D dissertation, ≤RW(bi)−H(YˆWXW|XWCYˆWC\{bi}Ybi) [4] ST.taHnfoo,rdR.UKniove.,ttCerA,.MOc.tM19ed8a0r.d, M. Effros, J. Shi, and D. Karger. “A =h(bi)(W) (19) random linear network coding approach to multicast”. IEEE Trans. V Inform.Theory,52(10):4413–4430 ,2006. Using(19),thefirsttermof(18)canbesimplifiedasfollows: [5] M. Bakshi and M. Effros. “On achievable rates for multicast in the presenceofsideinformation”. inProc.IEEEInt.Symp.Inform.Theory H(U |U ) ≤ min h(bi)(W) (ISIT),2008,pp.1661-1665. S A\S V [6] L. Sankar, G. Kramer and N. B. Mandayam. “Offset encoding V⊃W⊇S: bi∈WC for multiple-access relay channels”. IEEE Trans. Inform. Theory, 53(10):3814–3821, 2007. (=a) min h(bi)(W ∪T) [7] L.-L.Xie and P. R. Kumar. “Multisource, multidestination, multirelay V V⊃W⊇S: wireless networks”. IEEE Trans. Inform. Theory, 53(10):3586–3595, bi∈WC 2007. (b) [8] G. Kramer, M. Gastpar, and P. Gupta. “Cooperative strategies and ≤ min h(bi) (W\T) capacity theorems for relay networks”. IEEE Trans. Inform. Theory, V\T Vb⊃i∈WW⊇CS: 51(9):3037–3063 ,2005. [9] M. H. Yassaee and M. R. Aref. “Generalized compress-and-forward = min h(bi) (W) (20) strategy forrelay networks”. in Proc.IEEEInt. Symp. Inform. Theory V\T V\T⊃W⊇S: (ISIT),2008,pp.2683-2687. bi∈WC [10] A. S. Avestimehr, S. Diggavi and D. Tse “Approximate capacity of where (a) followsfrom (19), because S ⊂W∪T and b ∈/ T gaussian relay networks”. in Proc. IEEE Int. Symp. Inform. Theory i and (b) follows from the first inequality in (19). (ISIT),2008,pp.474-478. [11] A.S.Avestimehr. “Wireless network information flow:adeterministic Now by induction assumption, the last term of (20) corre- approach”. Ph.Ddissertation, Berkeley Univ,CA.Oct2008. spondstothefeasibilityconstraintsofreliabletransmissionof U to node b overcooperativenetworkwith the set of nodes A i V\T. Hence U can reliably be transmitted to node b over A i original network. This proves our claim. Now it is easy to see that the first term of (18) is equivalent to (1), that proves Theorem 1.