Downloaded from orbit.dtu.dk on: Jan 07, 2023 Class D audio amplifiers for high voltage capacitive transducers Nielsen, Dennis Publication date: 2014 Document Version Publisher's PDF, also known as Version of record Link back to DTU Orbit Citation (APA): Nielsen, D. (2014). Class D audio amplifiers for high voltage capacitive transducers. Technical University of Denmark, Department of Electrical Engineering. General rights Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. Users may download and print one copy of any publication from the public portal for the purpose of private study or research. You may not further distribute the material or use it for any profit-making activity or commercial gain You may freely distribute the URL identifying the publication in the public portal If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. Dennis Nielsen Class D audio amplifiers for high voltage capacitive transducers PhD thesis, October 2014 Ph.D.Thesis Class D audio amplifiers for high voltage capacitive transducers Author: DennisNielsen Supervisors: MichaelA.E.Andersen ArnoldKnott DTUElectricalEngineering TechnicalUniversityofDenmark ØrstedsPlads Building349,DK-2800KongensLyngby,Denmark Phone+4545253800,Fax+4545931634 www:http://www.elektro.dtu.dk/ PhD-2014 Summary (English) Audioreproductionsystemscontainstwokeycomponents,theamplifierandtheloud- speaker. Inthelast20–30yearsthetechnologyofaudioamplifiershaveperformeda fundamentalshiftofparadigm. ClassDaudioamplifiershavereplacedthelinearam- plifiers,sufferingfromthewell-knownissuesofhighvolume,weight,andcost. High efficientclassDamplifiersarenowwidelyavailableofferingpowerdensities,thattheir linearcounterpartscannotmatch. Unlike the technology of audio amplifiers, the loudspeaker is still based on the tra- ditional electrodynamic transducer invented by C.W. Rice and E.W. Kellog in 1925 [1]. Thepoorefficiencyoftheelectrodynamictransducerremainsakey issue, anda significant limit of the efficiency of the complete audio reproduction systems. Also thegeometriclimitsoftheelectrodynamictransducerimposessignificantlimitsonthe design of loudspeakers. The challenge of designing a flat loudspeaker based on the electrodynamictransducerisstillnotfulfilled. Alternatives to the electrodynamic transducer based loudspeaker is the piezoelectric, horn, electrostatic and distributed-mode loudspeaker. The directivity of the electro- static loudspeaker combined with the low level of acoustical output power and com- plex amplifier requirements, have limited the commercial success of the technology. Hornorcompressiondriversaretypicallyfavoured,whenhighacousticoutputpower is required, this is however at the expense of significant distortion combined with a largevolumeoftheloudspeakerenclosure.Piezoelectricloudspeakerssuffersfromthe poorpowerhandlingcapabilityofthepiezoelectricceramic.Howeveranicheisfound inthemarketofhydrophones,becauseoftheexcellentimpedancematchingbetween thepiezoelectrictransducerandwater.Distributed-modeloudspeakersrepresentavery interestingattemptfordesigningflatloudspeakers. Thepoorbassresponsecombined withthediffuseanduncorrelatedacousticoutput,remainsachallenge[2,3]. The work presented focuses on the development of an amplifier for a special type of transducer, the DEAP (Dielectric ElectroActive Polymer) one. DEAP based loud- speakers work on the principle of the electrostatic forces, and possess some of the ii samecharacteristicsastheelectrostaticloudspeaker.However,theDEAPtransduceris constructedbyprintingcompliant,corrugatedelectrodesonasiliconefilm. Asacon- sequence a capacitive transducer emerges, which can be shaped into the loudspeaker membrane itself, rolled up into a transducer driving a membrane or being part of an activesuspensionsystemforthemembrane. InordertodocumentthefullpotentialoftheDEAPtransducer,suitableamplifiersmust bedeveloped. Thefrequencyresponseandlinearityoftheseamplifierisessential,as theapplicationconsideredisthatofaudio. Alsotheefficiencyoftheamplifierisakey concern. Anintroductiontotheprojectisgiveninchapter1,followedbyastate-of-the-artstudy in chapter 2. Due to the similarities between the electrostatic loudspeaker and the DEAPtransducer,thestate-of-the-arthasaspecialfocusonamplifiersforelectrostatic loudspeakers.Amplifiersforothertypeofcapacitivetransducerslikepiezoelectricones are also considered. Finally the current state-of-the-art for class D audio amplifiers drivingtheelectrodynamictransducerispresented. Chapter3givesanintroductiontotheDEAPtransducerasaloadinloudspeakersys- tems.ThemainpurposebeingtoestablishedthefrequencyresponseoftheDEAPinput impedance,butalsoinvestigatethelargesignalimplicationsofdrivingthenon-linear transduceroftheDEAP. 2-level modulated high voltage amplifiers driving the capacitive load of the DEAP transducerareaddressedinchapter4. Anamplifierwithfourthorderoutputfilterand full-state self-oscillating hysteresis based control loop is proposed. The control loop ensureshighopenloopgainandactivedamping. Activedampingisakeyfeaturein ordertoachievehighamplifierefficiency. In order to further increase the output voltage or reduce the semiconductor voltage stress, multilevel inverters as amplifiers for class D audio amplifiers was introduced. Theflyingcapacitorthree-levelmodulatedinverterisanalysed,implementedandtested. Acontrolschemeisproposedallowingforthebalancingoftheflyingcapacitor,while ensuringactivedamping.Thissubjectiscoveredinchapter5. Itisconcluded,thatclassDaudioamplifiersforhighvoltagecapacitivetransducerscan beconstructedwithTHD+Nbelow0.1%andpeakefficiencyabove80%. However the complexity of the amplifier combined with the current high cost of components, makes the technology of DEAP based loudspeaker unfeasible. Suggestions to future workinthepursuitofsuccessfulcommercialisationoftheDEAPtechnologyforaudio applicationsisgiveninthefinalchapter. Summary (Danish) Lydgengivelse indeholder to centrale komponenter: Forstærkeren og højtaleren. I de sidste 20 - 30 år har audioforstærkerteknologien medført et grundlæggende paradig- meskifte.KlasseDforstærkereharerstattetdelineæreforstærkere,derliderafvelkend- teproblemersomhøjvolumen,højvægtoghøjeomkostninger.HøjeffektiveklasseD forstærkereernubredttilgængelige,ogtilbydereffekttæthederingenafdereslineære modstykkerkanmatche. Imodsætingtilaudioforstærkerenerhøjtalerenstadigbaseretpådentraditionelleelek- trodynamisketransducer,opfundetafC.W.RisogE.W.Kellogi1925[1].Denelek- trodynamiske transducers lave effektivitet er et centralt problem, og en betydelig be- grænsningieffektivitetenafdetsamledelydgengivelsessystem.Ogsådegeometriske begrænsninger for den elektrodynamiske transducer pålægger designet af højtaleren betydeligerestriktioner.Udfordringeniatdesigneenfladhøjtaler,baseretpådenelek- trodynamisketransducer,ersåledesstadigikkeopfyldt. Deeksisterendealternativertildenelektrodynamiskehøjtalererpiezoelektriskehøjta- lere,hornhøjtalere,elektrostatiskehøjtalereogdistribueretmodehøjtalere.Direktivite- tenafdenelektrostatiskehøjtalerkombineretmeddenlaveakustiskeudgangseffektog dekomplekseforstærkerkrav,harbegrænsetdenkommerciellesuccesafteknologien. Hornhøjtalereanvendestypisknårhøjakustiskudgangseffekterpåkrævet.Dettesker dogpåbekostningafenbetydeligforvrængning.Piezoelektriskehøjtalereliderunder denlaveelektriskeeffekt,somdenpiezoelektriskekeramikkanhåndtere.Ennichefin- despåmarkedetforhydrofoner,grundetdenfordelagtigeimpedansmatchingmellem den piezoelektriske transducer og vand. Distribueret mode højtalere repræsenterer et meget interessant forsøg på at designe flade højtalere, men det dårlige bas response kombineretmedetdiffusogukorreleretakustiskoutput,erfortsatenudfordring[2,3]. Arbejdet præsenteret i denne afhandling fokuserer på udvikling af en forstærker til ensærligtypetransducer,nemligDEAP(DielektriskElektroAktivPolymer)transdu- eren.DEAPbaserethøjtalerearbejderpåprincippetomdeelektrostatiskekræfter,og harnogleafdesammeegenskabersomdenelektrostatiskehøjtaler.Transducerenkon- iv strueresvedatprinteeftergivende,bølgendeelektroderpåensilikonefilm.Somfølge heraf opnås en kapacitiv transducer, der kan udnyttes som selve højtalermembranen, ellerrullesoptilentransducerderdriverhøjtalerensmembran. ForatdokumenteredetfuldepotentialeafDEAPtransduceren,skalegnedeforstærkere udvikles. Frekvensgangen og lineæriteten af disse forstærkere er af afgørende betyd- ning,daapplikationeneraudio.Ogsåeffektivitetenafforstærkereneretcentraltemne. Enintroduktiontilprojektetergivetikapitel1,efterfulgtafenstate-of-the-artundersø- gelseikapitel2.PågrundaflighedernemellemdenelektrostatiskehøjtalerogDEAP transduceren, fokuserer state-of-the-art kapitlet på forstærkere til den elektrostatiske højtaler. Forstærkere til andre typer af kapacitive transducere, såsom piezoelektriske, betragtesogså.Endeligvildennuværendestate-of-the-art,forklasseDaudioforstær- kerederdriverelektrodynamisketransducere,blivepræsenteret. Kapitel3giverenintroduktiontilDEAPtransducerensomenbelastningihøjtalersy- stemer.HovedformåleteratetablerefrekvensresponsetforDEAP’ensindgangsimpe- dans,menogsåatundersøgekonsekvenserneafDEAPtransducerensulineæriteter. 2-niveau moduleret højspændingsforstærkere som drivere for den kapacitive belast- ningafDEAPtransducerenerbehandletikapitel4.Enforstærkermed4.ordensud- gangsfilterogfuldtilstandsvariableselvoscillerendehysteresisbaseretkontrol-looper præsenteret. Kontrol-loopet sikrer en høj åben-sløjfeforstærkning og aktivdæmpning. Aktivdæmpningeretcentraltelementforatopnåenhøjeffektivitetforforstærkeren. Foryderligereatøgespændingenellerreducerehalvleder-spændingsstresset,blevmul- tilevelinverterssomklasseDaudioforstærkereindført.Denflyvendekondensator3- niveaumoduleretinvertereranalyseret,implementeretogtestet.Etkontrol-loopsom tilladerbalanceringafdenflyvendekondensator,samtaktivdæmpning,erpræsenteret. Disseemnerbehandlesikapitel5. Detkonkluderes,atklasseDaudioforstærkeretilhøjspændingskapacitivetransducere kan konstrueres med THD+N under 0.1 % og med maksimal effektivitet over 80 %. Kompleksitetenafforstærkerenkombineretmeddenuværendehøjeomkostningertil komponenter,gørdogDEAPhøjtalerteknologienurentabel.Sidstekapitelindeholder en række forslag til fremtidigt arbejde i den videre forfølgelse af DEAP teknologien indenforområdetaudio. Preface ThisthesisissubmittedinpartialfulfillmentsoftherequirementsforobtainingthePhD degreeunderthePhDresearchprogramEnergyLabDKatthePhDschooloftheTechni- calUniversityofDenmark,DTUElektro,ElectronicsGroup.Theworkwassupported by The Danish National Advanced Technology Foundation (ATF) under the project number 009-2011-2. A joint research cooperation between the primary partners of DanfossPolyPowerA/S,DTUElektroandBang&OlufsenA/Swasconducted. Dur- ingtheproject,aresearchvisitwascarriedoutat"DepartmentofElectrical,Computer, andSystemsEngineering"atRensselaerPolytechnicInstitute,USA. Acknowledgment Aspecialthanksgoesto Mydeargirlfriendandfamilyfortheirloveandneverendingsupportduringthis • project. My supervisors, Michael A. E. Andersen and Arnold Knott for giving me this • opportunityandtheirsupport. ErikBruunforhissupportduringthefinalpartoftheproject. • Allofmycolleaguesandstudentsfortheirsupportandconstructivediscussions. • vi Contents Summary(English) i Summary(Danish) iii Preface v 1 Introductionandmotivation 1 1.1 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 1.2 BackgroundandMotivation . . . . . . . . . . . . . . . . . . . . . . 1 1.3 ProjectObjectives . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 1.4 ThesisStructureandContent . . . . . . . . . . . . . . . . . . . . . . 4 2 State-of-the-art 7 2.1 ClassDaudioamplfiers . . . . . . . . . . . . . . . . . . . . . . . . . 8 2.2 Linearamplifiers . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 2.2.1 Galvanicallynon-isolated . . . . . . . . . . . . . . . . . . . 10 2.2.2 Galvanicallyisolated . . . . . . . . . . . . . . . . . . . . . . 13 2.3 Switch-modebasedamplifiersofcapacitivetransducers . . . . . . . . 14 2.3.1 Proportionalgain . . . . . . . . . . . . . . . . . . . . . . . . 14 2.3.2 Non-proportionalgain . . . . . . . . . . . . . . . . . . . . . 15 2.3.3 Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 2.4 Summary . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 3 DEAPloudspeakers 21 3.1 Large-signalmodel . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 3.1.1 Electricmodel . . . . . . . . . . . . . . . . . . . . . . . . . 23 3.1.2 Mechanicalmodel . . . . . . . . . . . . . . . . . . . . . . . 23 3.1.3 Electrostatics . . . . . . . . . . . . . . . . . . . . . . . . . . 25 3.1.4 Acousticalresponse . . . . . . . . . . . . . . . . . . . . . . 27
Description: