. WE CAN HARDLY Boulevard Cleaners to Close in March WAIT... After more than 35 yearsofservice local drycleaner. tothevalley, MaryOlverawillcloseher Boulevard Cleaners and Dyers in Aboutadecadeaftertheywere mar- March. Regular customers will be ried, the young couple opened their asked to bring in their apparels and Boulevard Cleaners at 10 Raymond other fabrics by late January to both Ave., which despite being located on a assure attenive service and allow the predominantly residential streetquick- business to properly wind-down its ly found a core ofsati°fied repeat cus- operations during the month of tomers. February. "Qualityiswhatcounts,"onceproud- Cleaning has been a way of life for ly touted Adolph, who longadhered to Mary and her late husband Adolph, asystemhiswifeand hetermed "theold whose untimely deathofa brain tumor fashionedwayofdrycleaning." Offend- morethanthreeyearsagobroughtsad- ingstainswere inquired oftheirorigin, nesstotheirneighbors. after which great skill, attention and patience were applied for maximum "Adolphhadawaywith people,"said cleaningresults. Mary. "People came with their problems. He would teach people "WeVehadcustomersformorethan 25 years," said Mary, whose clientele something." even patronized Boulevard Cleaners Coach Dan Harrington's Wilson Warriors varsity baseball team is Mary was living in Bakersfield in despite moving from Visitacion Valley 1945, attending a beautician school asfarawayasConcordorSanta Rosa. bravingthecold,coldwinterbykeepingplayingskillssharpinanticipa- when she met her future husband, a tion of an exciting 1993 season. MexicoCitynative, thenemployed bya "I consider my customers as a big family." After 27 years, the business was forced to relocate at 168 Leland Ave. when the Raymond Ave. buildingwas sold. Their two grown children, Anna Marie and Henry, also assisted at one time with the grueling six-day weeks which sometimes lasted more than 12 VISITACION VALLEY hoursaday. "Wewould like to thank all ourcus- - tomers with gratitude for their patronage all these years," said Mary. ISSUE #78 SERVING OUR COMMUNITY JANUARY 1993 "Wehaveenjoyedservingthem." A LOOK AT THE YEAR AHEAD the percentage that can be charged. I My proposalwould have expan ded will also be exploring otherconsumers the definition of "public meetings" to uL,y... S7u-1n.n- tJ-,. DDUflO.T—if fAi&Scmt/LiIy.m»e/riwUeaip twhoerfkiirnsgtowfitthhebyuesairn,eassndanwdecwiolmlmceonrtcienuteo in the marketplace. iinncclluuddeesmepeutbilnigcsoofffiacanlys garnodupspwehnicdhs ' teaohbvceeooWrruneittothimosehuiosrcentefphauaettsnhutdirmfneaegpaowntplmhyipoateiniacctCrahhalasulni,necfgnmeoervrastniniiryaaoinnntn.shmioceBnaunugnttrs seeDItiemnneznjapmzuscldratometybadielutoorwsnnisoa,gnrsot-ekveotssesesmtrreoensmsmvo,.mtetuombsoseumguttaatolnhilioxa-unfmvngasuedftnseauaattrlef.mbaoreeirreafacil.oaousrrvmmmgs--.e- cpletaordurrounsEejctsevaitctnebotiuynioeeonpnnrattssilohouorarpniurerteegoiehzttddiehisncansgttceaooxorauutleurlrraymesgeectidahtnuuri,gdc'l,easdnitrwtniebseconul'numbdsddaugiosfselniutt--cg wpgtauoanobxudvlpleiardrceyntefamrruleesnanfodttussian,hndlecasllnadudfudobterpyhrpopiorhfuvifobatitlncyeieaclgoscrsroeoonrrusvfppigecserreonesgudn.ipicvsnee.Isngt counton;theirelectedrepresentativein exceptional students and studentswith Pubiicofficialsand thosewhospend the Legalslaturewill continue to focus Because of these bard economic special needs. taxpayers'dollarsmustunderstandthat onourstate'seconomicclimate. times,consumers'dollarsarealsobeing the current economicdownturn trans- stretched to the limit and beyond. My Democratic colleagues in the lates into a corresponding drop in State revenues again fell below the Helping consumers get the most for State Assembly and I continue to be revenues available to state and local Governor's estimates. From July to theirdollarscontinuestobehighonmy committed to cutting bureaucratic governments. Prioritiesmustbesetand October, collection of personal, sales agenda. I intend to pursue legislation, waste wherever possible to ensure the the public must be involved in setting and businesstaxeswere appproximate- once again, to keep bank and other maximum possible funding for educa- them. ly$300million lessthan Department of creditcardrates reasonable by capping tionwithinourbudgetconstraints. continued on page 3 Finance projections. If December's rteimvaetneudesS7fa.l5lbbeillloiwonprcoajsehctsihonosr,tatghee efso-r Here's What's Doing in the Parks during January of the New Year ifnintaelrersetsitnigngppeloapclee-opfrem-aCniyviflaWmoaurssaonld- theRceucrorgennitzfiinscgalthyaetarthceoeulcdoninocmryeamseu.st SBAATKUREDRABYE.AJCAHNUARY2 and9aS.umn.da-y7,pf.rme.e:aPdsmyicshsiicoFna.irS,.FS.atCuorudna-y dtDihreierrsst,sya-wfUoaunrrmiloMyne.dsapRyl,aioafnnHcIoannndcioealrns.srecco1iu0pt:i,0en0atnstd.o bctoeonboveeugnritnefidrtsahtenpsrptiraootriecte"ys,EsctohonefomSoupiteclaiSknueimnrmgihtaan"s milSiteaarcyoasotf BDaetfteenrsye:ChamEbxeprlloirne atnhde tF0y4oF3ra6imroorBrl1de-g.5i,1n09f-to5hr4mA8a-vt8ei0.o2n0a,.ndcaLllin1c-o5l1n0W-5a2y4.- e1n1:t3r0anac.em.gatMeeaeltontgheLiwnacloklnleBaoduelreavtartdh.e eeccoonnoommiycasntrdatpeugtyCtaolriefbourinlidaonsurbsatcaktet'os wiantcchhdaisdaepmponesatrriantgiornifolef.the12l:as3t0sitxo- Str1y0bian.gm.Nu-rs1erpy.m.a:rePal,anltocSaatleed iant tthhee 0R8e6s5e.rvations required; call [415] 556- wiaontcrook-nasfeoTnchuuessoosunurmtemhcieotnnseohcmoeiuscsladiirlsyheaslntpdepbsbr,uiinlidgt CB1aa:lt0lFt0peO[.r4mRv1.5T]ChMP5a5eOm6eI-bt8eN3rTa7l1ir.anngaetrBaatktehre gBaetaecht.o sPjlooaiunnttihsnw.getshtTehGceoarrnSdeterrnybooiffnCgtahleAirfGboarornrideaetnNusamtiavd&-e tBhrriCedoega-esmittlaoelBhaDikekeefrefnrBseoeamcHht.ihkeeEG:xoplldAoernescGreaentmi-ec wafttiuacollllawlidazeieranodmnciudldcruedcleveoeceamlosdponteploarietmsnetywge.bhauoaspgiwlneoaenunsdslat,doalehanxebdalompriwrnoaeevrnidka- ctFaaarnlnadeFdnslocaerrio-ttsflicliPslotooewirlhaydnilistcketaroCtssrah,eynr.mdolaluitEeggexlhshpit.lgFhohootrDurerstTeeogPssuuosrinan:wntta,durOrmhrSnleeayatn.ars ABPaavobrteok1a.u.ntpia.ccnmaa.dll:eLGCniaadnalrcredosnlednfnarsWroamiWsyoalrroiknocsauGthnoeodldpdt.neheenaLwrGeoaar9trltenhd nWat1tea:ar3nitr0tehssteIoIfo.3Bfr:ao3Dthm0trieseptrts.hoymser.iEwcalaMSsrc7etom0eal'pstysat.arttlkhhieRrdnaopegiuafngrelhoknctsarWenaaocbnerboglalvestde-.r opprlniaeoWnroiofrtfoikretesohr,uesr'akssetycawtolpeml,ipeaceanesndssoiaotftfiisatoohnnneyereAoecsffosmoneryommmbtiloicyps 6qu:i3MWr0eiAdnt;RotecIa8rlN:lB3iH0[r4Ed1p5i.A]nmgD.55AL6d-AvR1eeN6ns9Dte3ur.Srveast:ioWnsatrceh- yywa1seoo2l:uui3crn0iosnomtaerwmsu,ancskbtpifuoaortncrgecJha1tiin9swla9od3ilr.isemSpinoeStucueiidtng.ahndl-wecAuorlaprellstiehgabnhgedtaegassirmsnsiuassrotatefst FR08oe6rs95tea.r.vPmao.tiin-ot5npsa.lmro.e:nqgWuaiLrtiecndhc;oalcaanlnldB[oe4un1lj5e]ovya5rt5dh6.e- pDreredemmoticaurpmeasth,iacvrealaemlapldacenrotsmhbifiprn.aeuddSktaoynrdmoacekknedetlietsnhsge tsLhaaeugnoatonetnri.icnsLgeoafarronouuwrnhwdeirnRetoetrdheemyoigtrrBaaevnaltecsdhwfhraionlmde SbM3euaspceercuompmeprWasanoyin..edFRboayrnadmnaolarldeuMlitu.nsfTeohrumema,tfieo1en9i,9s ScBuaallnabroFDarraSinvtceai.dsicuom,SoHcacveerloLcekagStu.eanpdlaCyira-t sneyssstLeaessm.tayebaurrdweenptroeCsaelnitfeodrntihaenGsobvuesri-- acg1suo1i:mwd0eee0!lslaa.nmtH.dheeabyMivenayoerceturlabgaiiornrisdn.cgae.BnnceteghBliusisn.rindaeisrn9tsg:P0We0betilret-dro ScdaaUlylNf5D5r4Ao-mY96,1000J,aA.TmN.ueUtsoAd5RaypY.tm3.hrough Satur- .gsfeerraoDvtuuaunrtsdioknr:igysAaoVnaltlirvlgeieheetywweidaettfahlctoahhreasletevahaerosnlitiinendragtnyhiepnelbnCaadoqcnuko--ef wnoorrkweirtsh'acroemapsorneabfloermpalcegkiasglaetioofn,soamned CReitnstoenraptatrhkeinMgarliont HeRaedsleravnadtsioVnissitroe-r MARINHEADLANDS JP.aFr.leKennedy Drive in Golden Gate hreemsahionulcdomhmaivtetseidgnteodwiot.rkHionwgevwietrh,twhee quiGreuda;rdcailaln[s41o5f]t3h3e1G-a1t5e4:0.Takeapeek as RaoscokleditesrtwohRialnegyerosu:eIxmpalgoirneeasneravnitnig- WEDNESDAY,JANUARYo Gvernoronthisimporantissue, andwe aatndtheguhinsteomryplsaucrermoeunntdisngofthtehebuMnakreirns atierecrrsafitntmeirspsrieltetshietee.raSatnadffexapnldaivnowlhuan-t MARINHEADLANDS iatmrhnreaitesnseoaaynusgedreaeotrmfpoewrnphortrtieee,cgcshuetelicgnaotootneno.hsoriymemivcrweeinitfnfhocurelrmnett,ghievgiressril,onatwatitnhohden oHtMtfhheeeeaetdhtNMleiaamknrifeidlirisnsmt.tiasreHHsyaeiehralaietdsrhltewasorontraro.ydrksbi1uebV:sfai0ftfs0tpiretatorouomylr3tt:cCh3huee0rrnordtpuyae.gyrmah.s.t atp8i8aofrnooPkarnRlsmtEFepaiSfarefrIlkmadD.inIsRdsOoi1Nal2ied:k.3be0avCstaeeoltlei3sr:[a34dn10os5i]pan.tg3m3N.i1in-k1Mae5e4snei0at.t-e tlttoohisemtrWeeweMsoadtaftnryaeeiernnasdbrdiaHarasdegystaaoidcfnuloonarwmdnhetdehlstoen'ocaBaRlmlilorobdtdsishret:edoetrriILsetr.a'oesdgwJtonaohoeniadndtn We expect to reconvene a bi-par- Reservations required; call [415] 331- Presidio Cemetery Walk: The San bird watcher as he roams the park in tisanworker's comp forceshortlyafter 1540. Francisco"National Cemetery is the continued on page 7 \ G*«pnf||K 2 JANUARY 1993 which time he began toinquirewhy she Letters was in the area "in which this incident tookplace. Hesummoned Mr. Ishmael 3urch. Maintenance Supervisior for workscheduleinformation;foraccord- Dear Editor: ing to Ms. Carter'sjob description she was a groundperson. Therefore, Mr. The Geneva Towers management, Fleming, could not understand why csCdieooscnmtutorpariaittnneydeydstfaeaneifldnfcyaeoonrmdurproenltel"hoeeMudesJstosoiharnngfeeosSsrptmoeanfwtdraiorotmnto MMithnssac..tidCMCearanrr.ttteeBrruArcwwccaahossrpadrtaiosntvsghiiegdtneoledodctMahrtteh.ieosFnciohrouemtfdisuntilghd.eee i t - . ,•: / i•• •.•<(•« k>-iy'Xv^ GenevaTowers" article. ground area as her areas of respon- GenFeirvsta,TtohweerresaArepanrotmsiednetdsoootrheerxittshaant sibility fortheday. At that point, itwas determinedthat Ms. Carterwasoutside Secured emergency use only. All resi- of her assigned area. This been a con- sdatenrndutcsteexaidntdsonsftratfohfemihraGvueesne.ebeveaTnhTeporoewpneetrrrslayncaiernse- spsetalaslntetdmpocronontbshlisestmeawnntidltyhsMfhoser.htChaaisrstvbeeerreyonviecnrforutanhc-e- r> -:vv Vr tsSelhrdrSgvoefeucidgorhneadfdplroypoo.rnrtoMalescxoi.hbtibTtvnoigdnGoaaotrrhWrse.iastsotonustShwtsarisedeetobbB-y datMiesotc.neo.rnWAvmafeitrtntseeasrdtfitauohnrnatdthteMOarsfk.ifinniCvgceaesrrpttliegakracetenoidvoabnel,erlthitweaweanaerdsdn ) * V OSefcfuiricteyr. MO.ffiKceerndKaelnldalwlitahpprBoeaicjhiendg doewcnidepderosnonhaelrorwenastoonisn.terBveenceaufosreheorf i ' 1 'Jr'\~ pMrso.peWratextistdaonodrsi:nsftorrutchteeddohoerrsuhseewtahse wnuermeeroofutsheinSf3rmaectisoonrst,. Msso.meCaorftewrhwiachs t&W$Mi miss? attempting to activate [fire alarm- IS, eOjqoruneviuepsrpeseadot]nolnyf.,orDMesux.ritinCwgyanstthhefioacrouCeramsreetregorfenatcphy-e terSAmirintncaheturelrdy..Hutton. j< ' ' I~1,lk •! r?*i j'?H f^f• \ ttfl k3j. parently overhead the instructions cc: William Hutton. Property Su- given by Officer Kendall. Ms. Carter pervisior Sharon Brown, DirectorofFamil- immediately commenced to chastising Housing the officerfornot makingan exception ly atotttehmeptrulaet.diOsfcfoiucreargiKnegndaMlsl. mWaadtetsana Dear Editor: > i %v; ;q. > ; rC»; ^Q. y-r.\ v- '?-o ?'[J >' v v-'p vp ,, secondtimefromexitingtheemergency With the help of our schools should be institutions of theSupenntendentonacomprehensive doorbyreiteratingtheinsu-uctionsfor- severalpublicinterestlawfirms, such as education rather than alienation. The package to co-loacte community and mally given. Ms. Watts was advised a SanFranciscoNeighborhoodLegalAs- recent gangviolence involving increas- city children's programs into our :hird timeofthe prodcedure forexiting sistance Foundation, Mutlicultural inglyyoungerchildren, and the 14or 15 schools. When youngsters have dif- the building. Again. Ms. Carter lashed Education Training and Advocacy, yearoldscommittinghomeinvasionsor ficulties,ratherthanexpellingthem, the outwithabusiveremarksatthesecurity American Civil liberties Union of carjacking should not be a surprise. schools will rely on these children's officers and began to encourage Ms. NorthernCalifornia,BarAssociationof Whentheseyoungpeoplewerepushed agencies for services to help these Wattstothesameas Ms. Carter began San Francisco. Youth law Center, and out by our schools, the streets became youngsters while in school. Again, ro distort the exiting procedure, i.e., Legal Services for Children. I have their teachers. To help these thankyouforallyourhelpand support. thatitwasokaytoexitouttheemergen- finally moved the School District to youngsters,theymustbeinourschools. 1 trulydrawstrength from knowingthat cydoors. As the securityescorted Ms. decrease its number of student expul- I am firmly committed to keeping our youtoocaresomuchaboutourchildren Watts to the proper exit area. Ms. sions. Lastschoolyear, the Districtex- expulsion rate to the absolute mini- in thiscity. Thankyou. Carterfollowedcontinuingherabusive pelled an average of 26.5 students per mum. The next step will be to address Sincerelv, ldaunregsu.ageBeacnadusdeisMtsor.tiCoanrtoefrexiistapmraoicne-- mtoon2t.h3.3 sTthudiesnytesa.r,AtsheI ahvaevreagoeftiesndsoawidn. wtihlelbneeewdosrokfintghewsiethtrtohuebnleedwsBtouaderndtsa.ndI LBeolaarnddoVf.EdYuecea.tPiho.nD.Commissioner tenanceemployee, theincidentwas irr- mediately reported to the Director ot Maintenance, Mr. Larry Fleming, at Celeste Carter Christine Drummer. Well we entered the KWANZA Trameka FulbrighL Nicole Johnson. Celebration at one of San Francisco's FiveYears Ago inthe Natisha Evans and Charles Toll per- most beautiful socialite's home, formedtostandingovations. MTV. eat JACKIEGARRISON. Whatagala af- Grapevine yourheartout. EairiUI! Itwas a who's who event..The SPECIAL THANKS TO FLASH KWANZA JANUARY 1988 GIRLS FOR DOING AN EXCEL- fUirMstOJprAinc(iUpnliety)o.f tThoe strive for anids * Nine acres of land on the north LENT JOB IN 1992- maintain unityin the family community slope of San Bruno Mountain next to Ethea Lucas. K.e\inaMitchell. Bran- nation and race. JACKIE'S party ex- the parkwere rezoned in a unanimous dy Alexander. Christine Drummer. emplifiedthetruemeaningofUMOJA. vote bythe DalyCityCouncil. Damsha Mitchell. Ayesha Benson. FYI - "NGUZO SABA" The seven * After much hard work. Bay Area Ramea Lucas, Angela Saulsby, and principles ofthe KWANZA - DEC. 26 Mountain Watch volunteers collected Chanae Benson. Cbanae's mother, -JAN 2: 6,000signaturesfortheCaliforniaPark Cheryl Benson is the Mother of die aCnadmpWailidglnif,e(eCxaclePedAiWn)g BthoenidrIcnoitailatibvve Shirletha Holmes-Boxx rMhoenStohulfTorraDiencDeamnbceer.shoCwheirnygluswawsMhaCatt KajichaguIl'imao-jSael-fUdneitteyrmination 1.00*0.Surrounded by a lake oflollipops, HAPPY NEW YEARS!!!!!!! iHtaimsmleikre'sto dapnrcoefelsiskieonoanle ofdan- Ujimraes-pCoonlsliebcitliitvyeworkand h12o5urpsouonfdswoorfksuwgeanrtanidntmootrheetwhiannni1n0g0 ConstLeatn'ts loMooktbiaocnk otnoo19k92you to cdearns.c.e.CflHooEr.R.TYhLawnaksscfuotrtitngheupsuoppnortth,e KuuNmiaba- P-uCrrpeaotsievity entry which earned Visitacion Valley Amsterdam in the Netherlands - you Cheryl Imani-Faith CommunityCenterfirstplacehonorsat were able to see the Red Light District the Coyote Point Gingerbread House whereanythinggoes -women standing HUMTEKS POINT Competition. in storefront windows selling their * Schlage Lock employees showed bodies legallv. drugs beingsmoked and SHIPYARD PUBLIC MEETINGS theircaringattitudesbydonatingatotal sold legally and the BULL DOG Cafe of$84,848totheUnitedWayoftheBay whereyou receivea menuconsistingof Area. differentkindsofmarijuana Veryin- Mayor Prank Jordan and the Mayors Hunters Point * Visitacion Valley Elementary teresting tnp....the irony is that bike Shipyard Citizens Advisory committee invite you to School received a Distinguished theft is the major criminal act or participate in a series of public meetings soliciting public EfrloemmetnhtearCayliSfcohronioalSAtawtaerDdepfaorrtm1e9n8t7 theTrhee sWoCmuCchGfiorrlpsroAhigbaiitniosnt!!!G!a!!n!gs cisotmhmeenstcheadsuploeteonftniaeliglhabnodrhuosoeds maetetthiengssh.ipyAalrldm.eeBteilngosw ofEducation. (GAG) featured several pep talks to will begin at 6;00pm to 10;00 with the exception of the their teenaged counterparts covering meeting that is to take place at city hall. everything from AIDS to Gang Violence. They also took uswith them Downtown Comm. VISITACIONVALLEY to the SFPD/Gang Prevention spon- Thursday January 7, 1993 College EDITORIAL COWITTTE sored Wilderness Program. Gigi. Sun- 4th & Mission Sts. shine. Princess. Monica and others LenAppiano JulieKavanagh BDVooinnnncBieeenrtBtaComhnbeauorg AnLnaBeVraeKunadgaahrntLuoKnipenengz wceonurts2e5atfeGelten+Pianrkt.heTahireyonaltshoetRoookpeuss Thursday January 14, 1993 PFoerlttoolna&ReHcolCyeonkteerSts. WalterCorbin FlorencePevtherer riverraftingattheMotherLode. Great PatCrocker JosephPorter waytospend a safe and drug free sum- NOTE: A citywide public meeting is tentatively scheduled to SMrlethaHolmes-Boxx RvbySmith mer. WCC take place on THURSDAY JANUARY 2& 1993 at city hall. PVAvuaebl.llie.syShaeCndoFmrmmauonnncitithsylcyoC.ebCnyAte9tr4h,1e34V5,i0s<iR6ta?ay-cm6io4on0nd0 tooTkheoff with FtlheaisrhGmierslssa(gaegsest1o1t-h1e4i)r People with disabilities should feel free to contact us ExecutiveDirector: Julia A.K?v?nagh peers advocating education, drug-free regarding any resonable accomodation we may be able to Opinions expressed in the Grapevine lifestyles3ndotherissuesthataffectthe provide so you can fully participate in the meetings. dVoisinottacinoencesVsaalrlielyyCormemfulneicttythCoesnteero.f wcihtihldareJnr.ofStooudlayT.raTihneDyaenncdeedwhtehereyeianr- PSmlietahseatcon7t4a9c-t502M5r03W.ilbePrlteaBsaettcloentaatct74us9-2a4t62leoarstMst.hreReanddiays vited guests such as Cynthia Williams, prior to. the meeting date of interest. JANUARY 1993 3 A LOOKATTHE YEAR currents W3ve of "carjacking" in this AHEAD stateisthenewestexampleofthis bold- ness. I have developed a package of L. Kirk Miller AIA from page 1 ltieegsisfloatriotnh,isiinncclruedaisnigngilnycvrieoalseendt pcreinmael,- I, therefore, intend to reintroduce to help stop these parasities who prey similarlegislation tbissession, and Iwill on the honest, hard-working men and HOOD MILLER ASSOCIATES work with the Governor's office to at- womenofourstate. tempt to address his concerns. How- ever, given the severe budgetary con- These are just a few of the issues I Architecture 60 Federal Street ssttrroanignltys btehlireovuegthhoeuste ignodivveirdnuamlesnmtu,stI iLengtiesnldattiovepusressusei.onA,sIwaembehgoipnefthuel 1t9h9a3t Panning San Francisco 94107 be held accountable for the public dol- the changes in our national leadership Urban Design Telephone 415 777 5775 larstheyspend. will help unleash the best in alll of us. and look forward to working with the Wemustalsostayaheadofcriminals Governor and my new legislation col- whohave become more and more bold leagues to meet the challengeswe face intheircrimesagainstourcitizens. The in the newvear. JAMES PRESBYTERIAN CHURCH ST. COMMUNITY BOARDS OF SAN FRANCISCO 240Ldaiul Avenue SanFrancisco, Ca.94134 Telephone: (115) 5S6-6JS1 SERVING VISITACION VALLEY SINCE 1976 Hie Rev. Dr.JerryO. Rcsils Minister Church School Clnssos -9:15 a.m. Are you involved in a conflict? Sunday Worship Service - 10:30 a.m. Resolve it peacefully at no cost Wednesday Bible Study - 1 1:00 a.m. For Information or Assistance call: [•Yiday ColL^c RiMo Fellowship - 7:30 p.m. Saturday Choir Rehearsal • 10:00 a.m. 863-6100 YOUarecordiallywelcometojoin usfor study,worship, fellowship and service. We seek to leach the Bible and to lilt up JesusChristso lie can SE HABLA ESPANOL draw all persons to Himself. (X>METO CIIDRC11 THISWEEK. & Panda Restaurant Cafe PALACE PHARMAC]/ 2800 Geneva Ave., Daly City, CA. 94014 (415) 467-5232 VISHACWN VALLEy PHARMAC)/ 100 Leland Ave., San Francisco, CA. 94134 (415) 239-5811 $11 amua* BREAKFAST * LUNCH ' DINNER * CATERING ' FOOD TO GO OLIVER LEE, pharm.d. JOHN PH^M.O. % tl & BMMia± 73 Leland Avenue Open Mon. thru Sat. 585-6419 8:00 a.m. to 8:00 p.m. FIRST CHILDREN'S CENTER NEW A START a warm and nurturingenvironment HAIR STUDIO to help the child grow in selfesteem and social responsibility • Openregistration-enrollment • Afterschool extended care SPECIALIZING IN COMPLETE HAIR CARE • Please visitourcenterto sign op Men Women - - Children The center opens each week day 120 Lathrop Ave, 7. A.M. and Closes at 6:00 P.M. San Francisco, Reasonable Prices Classes for 2 and 3 years olds: Ca. 94134 Classes for 4 and 5 year olds: Classes lor Kindergarten. (415)468-4055 CALL an appointment for COME or IN (415) 584-3077 222 Leland St. San Francisco, CA 94134 4 JANUARY 1993 <H«<'Ul scheduledSaturdayperformancethere trailer, a sort-ofMa Kettle type,whose going nowhere, often ended with wasnothingtobefound. sixgrownchildrenfromapreviousmar- surprising results. His smashed-up remember storming out of the riagemadeup the restofthe Del-Ray's stovepipe bat occasionally caught on houIseveryearly thatSaturdaywithout handsandperformers. fire, theatrically exinguished by one of even so much as a piece of toast for Somebody must have gone out and theringcrew. breakfast, and peddling like a madman givenBunnyahandwiththings,because All in all, the entire show lasted WhAennartrhoewCtiwroc-ulsanCe&ayrmoGaiedn^sttoxilTalmcoawRrrenides orsahtoatvazoedsapr,erpvdteIeoldcryoatoluahnlerdrhofialissdneelbgedie.bkdtaehtFaitbntreyroTatemohdceniaryftcerclwnaeuciarllesvie,keraessltisrnaheorataimphdne-eyg wweaptvalaaesscrtehwfyiietsinlhnelicntwiihgenrecatputholshaa.petcerewnDtabahesyialrtn;g-owoRloieaunnecy.gkkeyatnNcofdtoo.bireobtnishgetettomeuonpiktt wccstiaaaoaslslmtiewfpcthrebheeyrein.fnnogcoAroralnmmrtsaaohinludocsneuetrdgsaehn4dd5wfateomrhuradirtsne,utnthebseeautsrtaa,lgdvyneme-oirdidtysesstfniphtaoeainn--t- sparse traffic from the old highway to sort of a wagon train defending itself Every kid in town, and then some, weekend,manyofthetownspeople,and the business section of Springtown, a againstanattack;mostlikelythatwould was crowded onto these rickety old nearly all of the kids took in all four pleasant little California town just far betheskepticalaudienceturningupfor portable bleachers arranged around a shows. Sunday's final performance enoughawayfromthehustleandbustle theshows. singleringwithjustenoughroomlefton even had a standing-room-only crowd, ofurban American life,yetnottoo far In the middleoffield amongsta dis- thefarsidetoallowtheactstoenterand enough to delight any group of per- buriedintothestickstobeoutoftouch array of miscellaneous circus-type exit Andwhatactstheywere! Nothing formers. with reality. Quite a fewyears had past things like ring sections, disassembled fancy, mindyou! Yet when the shows were finished, since I lived in town, but many of the bleacher seats, and a bunch ofcircular Dressed in bis stylish P.T. Barnum nearly all circus personnel seemed to houses Irememberedwerestillpresent platforms painted in the same, stylish attire with a bright red tailed coat and hidebackin the trailers, perhaps afraid as I drove across the old bridge at the motif as the poster, was a sloppily bigblackboots,Ray,assistedbyasome- to get too friendly with the locals. creek and turned onto the side road dressed, befuddled looking man with what scantily dressed Del in an outfit Everyone, that is, except Bunny, who which would wind around the large his suspenders banging down and lookinglikeitmighthavefitherproper- had a much more grotesque batch of field. severaldaysgrowthofbeardonhisface. ly sometime in the distantpast, started jokes for some of the adults, as he Suddenly, I became disoriented, as Adjacent to him on the ground con- the show by inviting a few of the kids poureddrinksin backofhis trailerand house after new house obliterated any spicuously half-wrapped by a dirty into the ring and asking their names, laughed up a storm. sign of there once having been a large striped shirtwas a bottle ofsomething after which he'd announce ficticious Early that evening, after the last of openarea. Legendhaditthat a profes- withastrangelookingbirdon thelabel. onessuchasRoscoeorLullabelletothe theaudiencehaddeparted,athorough- sional minor league baseball team bad Although it was still quite early in the restoftheaudience. Each kidwasgiven ly inebriated Bunnystaggeredfromhis onceAused the area asa springtraining morning,hemadeahabitoftakingcon- a specially made balloon animal,which trailer and began the taskofdisassem- site. decrepitold backstopdid sit for tinualgulps outofthat bottle, followed the ringmaster seemed quite adept at bling the ring. Tire tracks, hoofprints, yearsinafarcornerofthefield,butnow by a cough or two, and then the in- creating. andabunchofpeople'sstoriesonMon- everything was gone, replaced by evitable resumption of that puzzled NextcamethehorseacL..er...Imean, day were the only evidence something several new house-lined cul-de-sacs pony acL Space conscious Del-Rays had gone on in that field over the look, withstrangenames. "Excuse me mister," blurted out opted for the smaller animals which weekend. It took a few moments, but I finally Tony, "but is there going to be a show werejust as popularwith the adults as Springtown'sweeklynewspaper, the got my bearings straightened out, today?" withthechildren. Fourlittlehorses ran Review-Tribune,operated bycrotchety thank*toanoldoaktreewhichsurvived "You bet,sonny,"answered theman around the ringto pre-recorded music oldCyrusVonwog,ranaspecialfeature the changed landscape of what had withawidegrin,ashecougheda couple as Ray simultaneously talked to the about the performances on the front once been a familiarstompingground. moretimes, and then took his compul- audience, smoked his cigar, and page, completewith pictures of Bunny I stopped my car where an old green siveswigfrom the bottle. directed the less-thanspectacular leaps on fire and one ofthe poniesjumping fence once stood bordering the No sooner did he wipe his mouth overthelow-lyingobstacles. Peppy the overatwo-footobstruction. perimeterofthefield. I hadstopped my thananirratewomaninherlatethirties Pony, blind in her left eye, but decked Nobody ever heard anything ofthe bicycle on that very spot as a youth with a ton of ugly purple mascara and from head to hoof with ribbons and Del-Ray Circusafterthat Therewere, minagnaynydeagrosinaggso-otonrpeoasdtealdlttohethaedvweortoids:- trroauilgeerdswteoatrhienhgilatdhairdteeodusfrsopmaroknleeogfretehne Asltlrefaomuerrsp,ownaisesclweearrleyutsheedfabneffoarveoriatned. nevoerm,ofroertshhatowmsatttehre.foAllnodwiynegayresarla,teorr, Grand Fiesta Picnic; Springtown Bar- robe. She puffed frantically on oneof afterthe performances in a ridingring, therewould be no field. beque; the Del-Ray Circus...ah, those extra-long cigarettes as she a bighitwith thesmaller kids. yes...thatonebroughtasmiletomyface. pointedoneofher brightly painted red Next came the acrobats, jugglers, 1wasridingwithmyfriendTonyand fingernails towards the fence and andhighwirewalkers (okay, sixfeet off HolidayCard Recycling wtaecksepdo-tutpefdortthheecfoolrotrhfculomiponsgtDeersl-jRuasyt sthhirsiaefketde,rn"oTohne,res'osynoousbohyoswshheoroe,'sthilotow!o" tcohuentgsr,oruingdh;t?)bwuitthita'ssutchceesstiaolnenotfptehra-t Like cut holiday trees, holidaycards G'rcus. Well, with Vampira directing the formancesseeminglyaimedatduplicat- create wonderful sentiments but they com"iWnogw,he"ree.xcLloaoikmesdliTkeonity'l,lb"eaacgirocouds woauyt,oTfotnhyeafniedldIhasadquliitctklelytoasdowebuctourlidd,e iEndgsSoumleliovfantheShfionwe;rsstpunitnsnisnegenpolnattehs,e atriemeecoofloygiecaarllyyowuastteofcuhl.basIfethwiisthis otlhde one." both a bit petrified, but still laughing flying pins and the such; but which friends and don't want to give up the Actually, if a person were to judge about the great reception given us by seemed to be executed a couple of tradition, buycardsprintedon recycled performancesbytheircaliberofadver- thenewcomers. notches higher than talented kids paperandrecyclethecardsyou recieve. tising, then the Del-Ray Circuswas in- Wewereto find outjust hours later bouncingupanddown on the bed. Each year, Jack Earl)'provides a list of deedagood show. Hystericallysmiling thatthescaryladywasnoneotherthan Then came the dog act Several places that will accept used holiday clownsanddancingshow horses added Dolores, the Del of Del-Ray. Shewas breeds and several muts running cards. Thesegroupsusethemforsuch the frosting to a presentation ofjug- married to Raymond, or Ray, a sort-of aroundtheringinfriltyrainbowcolored thingsas teachingandfund raising. To glers,strongmen, and acrobats. Surely crossbetweenGaryCooperandMilton clown outfits, complete with the recieve your list of addresses, send a the field was more than adequate to Berle, ifthere could be such a person, pointedhats. Onewasactuallytalented self-addresses, stamped envelope to: accomodatethelargetentandquarters who smoked a big black cigar like enoughtobravethedangerofleapinga Jack Early, All-YearChristmas Cheer, neededforsuchashow. Groucho Marx while performing his few feet through a protectively over- 134 Pfeiffer Street, San Francisco, CA TonyandIquicklypeddledourbikes duties as circus ringmaster, horse sized flamingring. 94133. uptheroadandaroundthebendtoour trainer, rideoperator, anda numberof Periodicallybetweenacts, Bunnythe homes, telling everyonewithin an ear- other positions way too numerous to Clown,whoseonestrongattributewas Treecycling" hot of the wonderful event coming to mentioninasingle breath. sounding exactly like Larry Harmon, ourlittletown. I'mprettysurethatboth And what of the bottle-swigging, the original Bozo, ran into the ringac- Recycleyou holiday tree. Ifyou live ofusexageratedthepicturesandevents suspender-hanging, put-the-pieces-of- companiedbysomeverystrangesound- inSanFrancisco, "treecycling"dayison printed on that poster, but that didn't the-puzzle-together man in the middle ingclarinetmusic, andwouldbegin tell- the first recyclingday afterNew Year's matter, becauseacircuswascomirfg. of the field? We would see him later ing a string ofvery simplistic, G-rated Day. Justput the treenexttoyourblue During the next couple of days, I that day in full costume as Bunny the jokesinastylenottoofarremovedfrom recycling bin and it will be picked up kept stoppingat the field everychance Clown, a character bearingsimilarities latter day Henny Youngmaa Bunny with your other recyclables. Call 554- Igot,lookingforsomekindofevidence to Red Skelton's Freddie the was actually quite an accomplished 6193 ifyou miss the collection date or of the pre-planning, but even on the Freeloader. Bunny was engaged to magician,asmanyofhiswellsequenced foralistingoftreethecollectiondateor Friday afternoon before the first Bonnie, the lady at the concession tricks, which at times seemed to be foralistingoftree drop-offlocations. DAILY LUNCH SPECIALS Leland Locksmith CATERING AVAILABLE OPEN GAME DAYS 200 Leland Avenue Hours:Mon. thru Fri, 7.00 a.m. to 4.00 p.m. 587-8403 Executive Cafe SALES * SERVICE * REPAIRS KEYS MADE WHILE YOU WAIT 150 EXECUTIVE PARK BLVD. SAN FRANCISCO AT SAN FRANCISCO EXECUTIVE PARK Open Mon. thru Fri. 9 a.m. to 5 p.m. Sat. 10 a.m. to 3 p.m. (415 - 468-0500) Tuntex Properties, Inc., San Francisco Ar>n|«rl,<Ik*VWtartalVtll»fOrapvTlnafurvUdkrplh«B«nPVanciamArt*Ommi««»l ISSUE U GRAPISVINK YOUTH SUCTION JANUARY 1993 WES ONCE UPON WINTER AT FESTIVAL A TIME... The add-a-story contest This is a new contest in the Totally Cool Vine. Here is how to enter the contest: Helptofinishwritingthestoryabout the Beautiful Princess that you see below. The story below waswritten by 9 people...so far. Each person in turn added a sentence to the story. It can haveasmanysentencesinitasyouwant, and be written by as many people as want to help write it. Be sure that everyone who helps write it puts their namedownasa"co-author",sothatthey all can get credit fortheirwork. When youaredonewithyourstory, send it to the Totally Cool Vine, c/o the Grapevine, 50 Raymond Ave., San Francisco, CA 94134. The winning writers will have their story printed in he March issue of the Totally Cool i Vine,andalltheco-authorswill receive certificates ofpublication. Hereishowvour storvwill start: THE BEAUTIFUL FAIR PRINCESS Once upon a time, there lived a beautiful, fair princess. She loved to makefriendswithotherpeople,andshe By The WonderfulAridFamous lived in a big castle. Her father, the ThethemeforthisyearsWINTERFESTIVALatWES is"ATIME FOR Writers: Ming Lisa,Jesseina,Monique !"vjng.chosetopickapnncetomanyhis GIVING." All the classes performed on stage forthis annual celebra- On December17, 1992weVisValley daughter. Many princes wanted to tion. ElementarySchool, hada Winter Fes- marry the beautiful, fair princess. But tival^Time forGiving. Manyclasses todoso,youhavetoprovethatyoulove participated in this wonderful pro- her. One of the princes tried to prove gram.There were many Christmas himselftoher, butshedid not love him. carols,pla\s,dances,andreadingsper- She did not love an)' of them. She formed. Room 16, 17,101, 104, 204, 207, wanted to pick her own pnnce. She 201, 202, 203, 205, and 207 did wanted them to love herforwho she is, Christmas carols. Room 105, and 102 and notwhat she is. One day. a prince did plays. Room 108 read Twas the took the princess away to a far away Night before Christmas". And last but land. Then the prince took the not lease , room 209did three raps. .-VII princess* hand and kissed her. The theclassesdidawomderfuljob,thanks princess suddenly fell in love with the totheteachers,Laura Ellis, dance stu- prince. They lived happily ever after, dents, Mr. Chao, and the friends and until... families who participated in this wonderful performance"Winter Fes- Registration for Art Studio] tival, a Time for giving 92". Registration for youth, reen and AUDITIONS FOR THE adult classes is now being held for the SAN FRANCISCO CITY Sharon Art Studio at Children's CHORUS Playgroundin Golden Gate Pmk.. Fees wiil vary by classes, which will be held The San Francisco CityChoruswill fromJanuary4throughMarch27. Pre- hold auditions in late December and registration is required. early January for the Spring 1993 Youtfcs S to 11 can create theirown season. Thechorusisa groupofabout uniquejewelrydesignsusingavarietyof w6i0tmhesnhaarneddwoinmteernesftroinmamlaltwailnkgsmoufsliifce matTereieanlss,12intcolu15diwnilglmweatnatltaonsdigcnopuppefro.r experiences in a spirit of camaraderie. Drawing and Painting. Magical Myriad The chorus has performed works by of Masks. Animated Workshop or Jewelry, Handel, Mozart, Monteverdi, de Vic- Adults axe offered Leaded Glass, toria, Ariel Ramirez, Palestrina, and Mendelssohn. Drawing jnd Painting. Life Drawing, Under the direction of Frederick V.atercolor, China PaintingorJewelry. Goff, the group will perform Leonard theTSiiaenSFhraanrcoinscAortReSctruedaitoi,oanfaancidliPtyarokf Bernstein's Chich Psalms. Aaron Copeland's In the Beginning, and GDreepearntmDerinvte, biestwleoceanteKdinognanBdowKleinn-g Choral Dances from Gloriana by Ben- jamin Briaen in April. Renaissance nedyDrives, andcan be reachedat 755- 7006. musicwill be performed in June. voiAcenyaondnerewadhsomuhsaiscpclaenajsoainnt. Wsiengairneg ACall For Umpires jj especially interested inceasing our tenorandbasssections. Rehearsalsare Ifyouare 16yearsofageorolderand held on Wednesdays from 7:00 to 9:30 enjoy baseball andyoungsters, the San p.m. beginning January 6 thru June in Francisco Youth Baseball League \8 the music room at Washington High looking for you. Umpires are needed School[30thAve.atAnza]. for youth teams participating in the Rehearsls are held in late Dec. and Spring League. Special umpire Mrs.HENDLEVS3rdgradersperforming"AMARTIANCHRISTMAS.' Jan. Formore information and an ap- workshops will be held, so no ex- pointment, please call [415] 563-S826. perience is necessary. The San Francisco Youth Baseball Thanks to the U.S. Marine Corps Reserve and P. G. 4 E MRS LReecargeuaetiisonspaonndsPoarrekd. bFyLSAaMnEF,raanncdistcheo CLAUS (a long-time resident of Vis Valley - Mrs. Lois Castillo) and her Police Activities League. Additional reindeer brought toys to all the children of WES. informationcanbeobtainedfromJohn i -Peterat 753-7029, orRogerBrossat 566-9600. B JANUARY 1993 Proper Fanily Nutrition a Key for Health During Winter Months STORE FOODS SAFELY kMeeaetp,fpoooudltsrmy,tfihsehraenfrdigreerlaattoerd(laetft3o4v°er-s3s7h°oFu)ldnobelorneglenrgetrhaatnedthoernfruomzbeenrFoofrdbaeyttsersufglagveosrtaenddbsealfoetwy us,Wtihtehimtphoerctoalndcewionfteprrompoenrtnhustruitpioonn wbietbhelotwheacenrutamibnelervelowfhipcehofpllucetuapteers Refrigerator: Freezer - no more than anda balanced dietisessential forcon- household; incomefora familyoffour, tinued good health in our families. forexampleshould total below$15.125. • Fresh fish 1-2days 6 months Smart meal planning could mistakenly EFNEPhasassisted more than 450.000 • Chicken 2-3 days 12 months • Pork 3-4 days 6 months be labeled a low priority by many ofus t'.imilies since its inception in 1969. with • Beef 3-5 days 12 months in these difficult economic times, but 'anaverageofabout 20,000new families • Cooked beans 4-5 days 4 months there is help available for people need- expected to be reached eachyear. • Gravyanddressings 4-5days 4 months ing assistance in choosing the right Paraprofessionals, as employees of •• ECgogosked meats 42--53dwaeyesks 3 months foodsfortheir families. UC'sCooperativeExtension,arehired, Administered in California by the trained and supervised by home STRETCH YOUR MEAT DOLLAR University of California Cooperative economists to provide instruction for Smallamountsofmeat, poultryor fishcangoa longwayifyoupreparethemwithother Extension, the Expanded Food and small groups. Thosewho complete the foods like Nutrition Education Program program are able to use their EFNEP • Meatloaf, meatballs with breadcrumbs,oatmeal, (EFNEP) provides low-income knowledge and skills to provide more rawgrated potato families, especially those with young economicandnutritiousfoodsfortheir • Ground meat, poultrywith macaronior anyother children,witha basicFive-pointconcept families. pasta in educating homemakers to improve Evaluations of participants' diets • Rice withchicken, meat, eggs theirloved onesdiets by understanding show significant and continued im- nutrition, shoppingwisely, and prepar- provementsintheireatinghabits, espe- • Liverorotherorgan meatswith vegetables ing and preserving food safely while cially in the consumption of dairy orotherfoods learning about good nutrition and products, fruitsandvegetables. VEGETARIAN MEALS CAN BE NUTRITIOUS health practices. More information about EFNEP Tnehee)parroetehiinghofqubaelaintsy,prrioctee,icnowrnh,enwheeaatte,nbrIneacdo,mbtoirntialtlaiso,nasnldikfelourfromcereals(wheat,corn,oats, in EMoFsNtEcPurrreeqnutirgeuidthealtinfeasmfiolryeilnnbciolimtey c1a-n510b-e64o2b-t6a4i4n1edorit1-51b0v-9c8a7l-li0n1g43e.ither • Beanswith riceortortillas FOODS THAT CONTRIBUTE TO PREVENT ANEMIA • Ricewitheggs Irondeliciencyanemiaisverycommon,especiallyamongchildren,leenagers.andadultwomen Foods richmironhelptopreventirondeficiencyanemia Organmeals, meal,beans,lentils,eggsandotherfoods • Peanut butterand bread are richmiron Seebelowtheamountofironinonenutritionalserving • Pasta andcheese Iron infoodsisbetter utilizedinourbodieswhenfoods rich in IronareconsumedwilhvilaminCrich COOKING SUGGESTIONS foroovdesgestuacbhleassaodldreudsflrouidtsi,shceasntwaelouepate.,cbarnocciomlpir,ocvaeuliirfolnowienr,ougrredieent.pepperandcabbage A fruit, a salad • Trim visiblefat frommeatbeforecooking iron supplementsshould nol betakenunlessrecommended byaphysicianor registered • Do not overcook meat, poultryor fish Overcookingdecreasesthenumberofservings, tdaikeennnan Ifironsupplementsare prescribed, onlytherecommended amount should be toughensthe meatand reducesjuiciness • Cookbeansproperlyandaddenoughliquid Undercookingorusinginsufficientcooking Excessiveconsumptionof ironsupplementscandecreasetheutilization ofother nutrients inour liquidgivesunsatisfactoryflavor bodies • Skim oft fatfrom meatjuices,or blot liquidfatfrom meat with papertowels. How Much Iron is Recommended perDay' Uver (pork. beef, chicken). 302 Iron9m5g Age, years Male, mg Female, mg KHieadrntey(p(oprokr.k,bebeefe,l.chcihcikcekne)n,),3302oz 6731 ••UsuBLaeelaslnsysl,LeencshdsiecrEkxceupnle,sntsouilrvkmeeeya,tesggasndgrouSnMdARTSHOP••UsPuBTIaeelNenllGd.yevMreoalrc.uellsaEmxbap.nendpsorihkvi,egahenrdlgurnacdheseonofmemaetasl P1IIrI9etogtoorn1am01n8otraendlactatingw111o002men 31110550 CSCCCoooooyoooobkkkkeeeeeaddddnrplsceieonundytrtibdolbes.e.aban8en1saso,nc,zsu,1p1cc1uucppup 5444633925 meat (lom, T-boneandporterhousesteak) Squashseeds, 1 oz 42 • Liverandotherorganmeats • Regularcutsolmeat Cooperative Extension Tuna fishand sardines, 3oz 26 •• PGirnattoedantdunmaostbeanssoldmbulk •• CBehaunnskatnudnalentilssoldmsmallpackages DUiNvIisViEoRnSoIfTAYgrOiFcuCltAuLreIFaOndRNNIaAtural Resources GDBerreyofu,pnefdaatsbfecreeofe.o,k33edoo.zz1 cup 222444 • Homepreparedmeat, chicken, hsh • (Psemadoyk-etdoaenatdbmeaartb,eqcuheicdk)en, hsh E»p«n<J«JFood»rxjNutritionEduc'.or.Program HEgogts,dog2s. 2 (2ozeach) ?204 • Storebrandandgeneric loods • Nationalbrandloods PPoeualntruyt,bfuattlefrr,ee,43taobzlespoons 11 02 LEN'S SOMEWHAT CHALLENGING MAZE WOODROW WILSON BASEBALL SEEKS PAST PLAYERS, COACHES The Woodrow Wilson high School BaseballProgramisplanninganalumni game and return and reunion, in addi- tion to several other events, to help celebrate thirty seasons of varsity baseballcompetition on thepartofthe Warriors. All former baseball players and coaches are welcomed to contact the current varsity baseball coach, Dan Harrington,formoreinformation. Call 469-4550duringschool hours, orwrite WWHS Baseball. 400 Mansell Street, San FranciscoCa. 94134-1898. VISITACION VALLEY TOTALLYCOOL VINE u YouthSupfllKBMl Conchit* Bnpflfa HoiMuDm MJaeraidnoaaHAgdoama AahleyMartin Lit* 3aalaa TUltaHoward Mix*Saala* CarrieHoward BufeneLaoejr Ji Moniqua Sartdoval Advw*.; Victoria •>uli» Km, rxcjdd Mr.Lae-y JANUARY 1993 C New Directions Program Designs New Ways to Reach More Families FOR A HEALTHY MOTHER AND BABY California's Expanded Food and food safety and sanitation, and use of Follow these recommendations Nutrition Education Program has im- commodities. ... plemented an innovative spin-off en- EFNEP is 3lso expanding its ttihtrleedem"aNjeowrDpirroegcrtaiomndse"liwvheircyhmeptuhrosduse.s acbyuodmtirmaeuinnnciientgybtyhaegiecrnoscotiraedfsfisnaaantndidnovgroglwauinntithzeaeotrtisohnetsor bEatraetlaekaafnsatsattd;herqteuoeoamtmeeaaanlmsyophueonrutrdsaanywditDvhoaonru'itettfysokooifdpfcoaonds Eat Throughproviderandclientsurveys, deliver the program's nutrition educa- affect your unborn baby. EFNEP's Food Access Program helps tioninformation. sciosmtmauncneitnieeesdasssaenssdedmeevregleonpcsypfloaondsast-o proSbplaenmisshrelraateddiototfaopoedscofnocsuusmipntgioon,n Gduaneidvneeirlnwogepimegenhnottubgoehffoywroeeuirgphrbteagbinsy.aInmIcfpyoy,rotuyaonwuterfoer the address hunger at the local level. shopping skills, diet improvement, and areadvised to gain between 28 and 40 lbs If you EFNEP also assists providers and money savings have ben developed by started pregnancy with adequate weight, you clientsofemergency food systemswith EFNEP 's Media Development Pro- sDohno'utldtrgyationlboestewweeeingh2t5daunrdin3g0plrbesgnoranmcoyr.e. nutrition education and technical sup- gram,whichhasalsoperoducedaseries port. Nutrition education topics in- ofthreeto five minutevideotapes each Visit a doctor within the first weeks of clude: food budgeting, meal planning, targetinga single nutrition topic. pregnancy. Diabetes, hypertension and other health conditions can be discovered and treated before they affect your pregnancy. Better Nutrition Starts With Better Meal Planning tipsEfForNEbePtterrefcaommilmyennudtsrittihoen:following ltehses.pAriHcefopoedrssheoruvlidngbeinpumirncdh.asAedbwointyh pkIfrnoyotoweucteaaryreloyuurssiobnagtbhyme.esdeiccaatniobnes,chleatnygoeudrifdonceteodred to Besuretoplanyourmorningmeals. meat cut, for example, may be low in Bbreelaikmfiatesdttdooberseankoftasntecfeososdasr.ilAy hpaevresotno pinngcsetphearnpaonuontdh,erbucuttwiolflmyieealtd.*leBssnserv- mAevdoiicdataisopnisri,nlaaxnadtiovtehseranpdaionthreerlioevveerrs-,thsel-eceopuinntgerpilmles,diccoaltdions, falsi Vl_*** caneatjustaboutanythingnutntous. Differentformsofthesamefoodcan thaFnonoedesdepdreatpaarpeadrtiincullaarrgmeeralqusahnotuiltdy bPreicceosmpoafretdh,e assamweellfoaosdthmeairysvizaersy. «gArvoowitdhdarnindkiinngtelallicgoehnocleicofbeuvnebroargnesb.abAilecso.hol can Impair the be immediately refrigirated for future depending upon how it is sold: fresh, consumption. Leftovers noteaten at a frozenorcanned. Freshproduceprices previous meal should be used within a varywiththeseasons, butsomecanned nAovromiadlogrrloiwmtithcaingadrehtetaeltshmoofkiunngb,orans ibtacbainesdecrease the day for safety and best flavor. If your and frozen vegetables may be lower in family enjoys snacks, select foods that pnce than fresh vegetables out of willcompleteyourdailyfoodneeds. For season. Andalthoughthelargestsizeof tuIfseyotuheemnjionymcoodfefreaetioront.ea. Including herbal tea, example, if your meals o not have a grocery item is usually the best buy. ethneonugihn fsrnuaictskso.rdaGioryopdroidduecatss,iinncclluudde:e yproiuce,syhoouurldstoarlasgoedceaptaecrimtyi,neandit'isfyuonuirt rIfecviotmammeinnsdeadn.dTmoinoermaulcsharoefpsroemscerivbietda,mitnaskeanodnlmyitnheeraalmsocuanntdecrease milk, yogurt, cheese, fruits,vegetables, familycan useitinareasonableamount the nutritional effect of other nutrients. hard eggs and leftover meats.Smart oftime. Food Shopping Means Better Family Understand the difference between HOW WILL YOU FEED YOUR BABY ? Meals.Altbough sometimes a cumber- generic, house,and name brandswhen sometaskrequiringwillpowerfrom the shopping for your family. Generic gimmickrystoresandsupermarketsim- (plain label) foods are usually the least Breast milk has everything your baby needs for growth. pose on their customers, smart food expensive of all, and have a nutritive Breast milk helps prevent yourbaby from getting sick. shoppingcan be made a more pleasant valuesimilartoexpensivebrands. Store undertaking when planned properly, or house brands, the store's own label, Formula Is another wayto feed your baby, but according to several guidlines sug- are usually priced lower than national breast milk is the best food for babies •MS* gested by UC's Cooperative Extenion or name brands, whose quality may be Breastfeeding can help you to losetheextra weight you gained during pregnancy EFNEP program. Before going to the touted as better, but have no better store, planyour meals for several days nutritive value than either generic or There Is no formula to prepare no bottles to sterilize. Breastfeeding saves you money. in advance, checking to see ifyou al- housebrands. START SUCCESSFULLY readyhavesome oftheitemsyou need Ifyour schedule allows ample time, tobuy,andwritetb*enecessitiesonalist getintothehabitofreadingfood labels, Start breastfeeding soon after birth and breastfeed rememberingtoincludesuchstaplesas printedonpackagingforyourinforma- often to stimulate milk production. Avoid bottles of spices, dry beans, flour, rice, corn tion and protection. Check each item water or formula for as long as possible. Bottles of starch, vegetable oil, pasta, sugar and fop package weight, expiration dates, fthoerymudleacorreawsaetefrrecqaunendceycroefassueckyionugr.mIinlkadpdriotidounc,timoonstas salLProviing you have access to good andprouctingredients. Read thepack- babies become confused sucking from two types of nipples. transportation, a market can be age weight, taking into consideration selected with regards to convenience that some large boxes maycontain the • Position yourself correctly, holding your andsavings. Betterprices are available same or less food than smaller ones. Ybaobuy'nseemdoustevherIanlfrpoinltloowfsyfoourrbneitptpelre.support at discount food outlets and national Make sure the "sell by"and "bestwhen of yourself and the baby. chainsthanatsmallconveniencestores. purchased by"datesgiven on each item Fbeorpautlrtoinmiazteedstaovicnogsm,psaerveeruanlitstporriecsescoann aafltleorwiytsopuuracmhpalsee.time to keep the food hcTleiocsokepleetnotshyeohuib,sabmmyao'kusitlnhogwwesirduerH.ephQweuitithcakkyleoysurpauslnlimptuphlceehbuanotbfiyl n the foods you purchase most often. Consumers,bothnormalandfollow- the brown area of the breast as possible. Generic (plain) labels often have ade- ing speciasl diets low in sodium, sugar quate quality, and can provide a sub- orcholesterolshouldcheckproductin- *oSnuctkhienngipopnlet,hIesbnreocwenssaarreyafoofrtmhielkbrperaosdtu,ctniootn].usTthe stantial savings over the brand name gredients listed in order from the most baby's Hps should makepressure on the milk channels items.Whenshoppingupanddownthe to least amount found. Check the underthe dark area of the breast. aislesofa supermarket, bewaryofspe- names of preservatives or other addi- cials. Although markdowns and tivesusedtokeep thesafetyand quality iWnotrhkeinregfrmiogetrhaetrosr ocranfrbeerzeears.tfeed. Milk can be pumped or expressed by hand and stored coupon savings products will save you ofthefood. money,tbeymayalso buyproductsyou •If you choose formula, prepare It correctly. Too much ortoo little water can be harmful to your baby. Follow manufacturer's directions. Cleanliness Is essential. Hands and don'tneed,can'tstore,orarestillhighly You should never go shopping for utensils needed for formula preparation should be washed thoroughly in hot soapy water. priced in comparison to suitable alter- foodanywherewhilehungry. Notelling natives. Alwayspurchaseproductswith wbatyou'llwalkoutofthestorewithon TVauthoruF.nnRoriKro-G*yn<ir*hD CommunityNutritionSptrulul.UnntnilyofCjlt'omu.•...,*.....< fincntKMi Anui.Piul.ncVu unit pricing and price per serving in an empty stomach. Have yourself a mind. Using the unit price helps you healthymealorsnackbeforehand, and USE SUGARS MODERATION 'ecide the size of product that costs then shopwithconfidence. IN Sugars Includetable sugar, brown sugar,rawsugar, sucrose, glucose, maltose, honey, syrup,corn sweetener, corn syrupand molasses. Afoodcan behigh in Fried foods and pastries are high in fat sugar Ifoneofthese sugarsappearsfirst orsecond on theingredients list onthe label,or ifthe label showsseveralofthem. Too much tat of any kind, Including solid, soft and liquid fat, can form fat In our bodies and Increase our body weight. Too much fat can contribute to overweight Sugarsareadded to foodsto makethemsweet,to preservethemorto make some and obesity foodstenderand moist. Sugars are In manyfoods, no!justsweetfoods. Overweight and obesity Increase the risk of heart disease, diabetes, high blood pressure and other health conditions. Sugars provide calories but are limited In nutrients. People who want to avoid gaining too much weight will benefit from eating less sugars and sugar-rich Too much fat, especially saturated fat and cholesterol, can Increase blood foods. cholesterol In most people. It Is important to have the blood cholesterol checked by a health provider. Cholesterol values above 200 Increases the risk of heart Sugars can contribute to tooth decay. The more often sugar-richfoods are eaten disease. and the longer they stay In the mouth before teeth are brushed, the greater the risk of tooth decay. Choosing low-fat foods is recommended for most people, especially persons who need to limit calories and persons at risk of heart disease. Limiting tats is Sugars in Selected Foods not recommended for children under two years of age. Teaspoons of Sugar (tsp) Pastries and bread: Breakfast Cereals: tsp tsp HOW MUCH SHOULD WE EAT DAILY? Chocolate cake, Iced 4oz 10 SugarSmacks, 1 oz 4 Angel food cake, 4oz 7 AppleJacks, 1 oz 4 CTPHERIEELNGDSNRAAENNNTDAANDDULNTUSRSINGMOTHERS . 223ssseeerrrvvviiinnngggsss(((122---233ooozzz eeeaaaccchhh))) CDCoohnfoufcteo,elagctalekaezc,eadk4e1,ozplain 4 oz 666 CFSrhroreseatdmeddeorfdicwwehh,eeaa1tto,,z11oozz 310 Pie, 4oz ' 5 Oats. 1 oz 0 Toast, plain 0 D JANUARY 1993 49 £6 JO Cathy Kline — /??3 Sts/sM* — 21 I 10 yJg&MACy 28 A/jy — 27 lb fc&&Ai*Y — 25 — 24 Marketing ICOMKCHOMUNfflcouicicri*»1MCICO Senior AtA*c* 25 jZ*y 21 £ Consultant ill >^ a* Born and raised in Visitacion Valley -r/f -tfrva — -/7UJ HAPPY -b*8 NEW YEAR Dental Office Visitacion Valley brokerage Albert Kuan, DJ>.S. residential services Grubb&EIlis 10% Senior Discount 2633 Ocean Avenue 37 Leland Ave., San Francisco, Ca. 94134 San Francisco, CA 94132 ton. • Pri. 9.-00 to 5:M Stturfty 9*0 U bOO Phone 239-5500 for appointment (415) 334-1880 CnntonsiD ipoten WCC BINGO RAYMOND AVE 66 Bayshore) (at SAN FRANCISCO or 5535 Uu^Cfr^ SUNDAY AFTERNOONS AT 1:00 P.l\ DOORS OPEN AT <? 1 1 :30 A. M. $63 00 * 1 0. PA YOUTS EACH GAME GUARANTEED! 2 PAD MINIMUM PER PAD) - ($5 a w .. .. . . JANUARY 1993 g SAN FRANCISCO UNIFIED SCHOOL DISTRICT EDUCATIONAL PLACEMENT CENTER 135 VAN NESS AVENUE - ROOM SAN FRANCISCO, CA 94102 (415) 241-6085 1 Dear Parent/Legal Guardian: Estimadopadredcfamdiaorutoq W1e993-w9o4uidPrea-pRpergeicsitartaetiyoonu/rOpttaikoinnagltEinmeroltlomernet*lRetqhueesftoll(oOwEiR)ngPrioncfeosrsm.ation regarding the uAccuodnUin(uOa.cEi.oRn.)c.nccoonrtrrcasrpaonidniiconrimcacaildcnicvlaolieosscaolaacrcr1c9a93d-c9l4a.matrtculacscoIotydelproccsoparasolicituncambiodc ACE R.EQUKFIiiRnrEdsetMrEgNGaTrrSatd:een:: HHuusstt hhaavvee bbeeeenn bboorrnn oonn oorr bbeeffoorree DDEECCEEMMBBEERR 21., I1S9»8B87 REO••lPPfiarlraaSkpairTnidOmeSerr,RglrFoas.dIcos..tAuITdoIjiaVcnOsi.tcuSsdidAaenbteLcnsAddeeFbh.eaDntAedDrc:MhCailxdrondac2idUoccdli2cidccmbdrlccidccmb1r?c88dcP.1a9n8u7soantes. REQIflSHflS A LA HORA DE ENTREGAR LA SOLlCtTUD REQUIREMENTS AT THE TIME OF SUBMISSION OF THE APPLICATION •Pruebadesudomicilio.lacualdebedcscrunadclassiguicnics 1)LalicenciaparaconducirauiomOvdcsocl . aDaoVTdetdeedphdlrraereierrepfstshismsocgeenaondetvtiemrounsnBttmiooelfnlot;tfbhaee«l:otpch(aoea4r)rg(eeh1nn}oHVctmeey/edDh.lirie-ciagClvdaaeedllsrrI;'efssSgstutiaLh(crioe2,kfdceieDranrCtnsuiherveorefferprona'rottrsmheeIn.PLttD.pih./Oaec.releen6DgnsecatepaEl/ar.lrdoetrggmubiaeiasIlnlr.stlDdu;.ieadgonfucaa(rbr-3Sdydo,icTaihChnaeuat;lsrhrPeerSbnoee(toerC5f)nvailcioPcfef-LhsoCearithnno/tgimleeoaeCrdr nccLPaaaurcmrzuieumelyidbciGdnaraclisgoIdi.de(dca2Pnl)uaaCfCuicfsc&retauccchfdEiaiOpc)nodarecd3lmop)iandiUneianledcoiHdrmeoeplicsoicprDbniccoullpJoaDaccntd3upea)alamlAneecdanstcmilaeouladdndcliccaooBnSmatdceucpr.uavTsinlrc/maaiaonoc.sdsucan4Slo)otccdpTilacuadrelfCjdcoacesnlLoiaosfsodcd(rrecPnlaiuocaMnti.carfdaii2dcd)-ccBCUpeallncallsn.)rd.seci4cng)icubiTioaacrnagjclctucutsbaaelIdm)deaclAmclMcatcnacduiolo-m.CppaaalAr.lua5d)adcUdnca within the past ninety (90) days, a second verification will be required. Siporalgunmoilvonopuedeprcscniarlosdocumcniosmcncionadosanicnormcnic.porfavorvengaanucstras Pcreorotfifiofcatbeir,thordaHteedi-iCnalthestifcokremr.of a birth certificate, hospital record, baptismal oonfbcilccicigsnaaacsni.oo.nNcosswqrueostosdaobselmoosscsqtuuedihaanytcfsamlielnigaasniancdcoccsuomacnliaacddauscaociqdunecpaurbclciccan.dpeorunloholagnalro.pIccramyaundcnairecmoNsucesnirloaquesea APPLICATION PERIODS Begins Ends Notification to Parents rERfODOS PR SOLICITUD Emulua. Hmliia. Fcr.ru dr. Nnlirkatiftn. FSTiehrcisortnddPPeePrreiirooiddod 11i1///113/809//39932 316///311155///999333 WWyeeeeeekkk ooofff 357///831//899/3393 23lroedr.pppeeerrriiiooodddooo 31I80dcddccabenrnoiclvr.docddc1e91919399923 311155dddcccjemunacnrrizooodddccc111999999333 SSScccmmmaaarnruaudddeeelll83l8dddcccmmjaaurylziooodddccc111999999333 GENERAL INFORMATION Apclacion 20dcjuliodc 1993 6dcagosiodc 1993 Scmanadel20dcagosiodc 1993 Applications will be available at all school sites. 135 Van Ness Avenue lobby, INFORMATION CiF.NF.RAl.: and the Educational Placement Center. They may be submitted at any school site or the Educational Placement Center - 135 Van Ness Ave.. Room 1. •Lissolicitudescstandisponiblcscnlascscuclaspublicas.cnclvesifbulodclasofiarusccnlralcsdelDistnioEscolar PbacAb1arsopa2se)sipli-inrasrgcon,enivcimgdaefeielnssttnwotroifwhartiethlailcstocwhttnioebhulreedlderiaOnmenpstaqgts'dpuiisereogestnn-toweamrehnleeedrtnngohtilEessslnc(tmrhh1ero)oowonalimltltletlmih(eoeawsnn)ridntledoltraeCcgisoscubnsmeooa.tprrsumdaptainaaedntcdregeeAvesesroRmtnisaoegnplnldtgymaoahucemeiendimtefPrmeslirpeniraoqtcsncwutteieel-ssslcstaotetsmdbaeheeten,dgtrrhfaeaortdfnraieidctmihroesalscmllhiiteonvz-/ioeeesnellsdet.rhvnateinothdcdfoe cdccc•a•scndLLcmcpuaoulucpcsscaicnarclsOadidaoaficloldivnupicoacaumclsiibinqnaltpcouasuirnsed.co#ealc1nIusaccoobdsssipeocesocclbrcnand'ardDceccnaailcnntssopcDuemicadccloaerncprpcuigaadccnmralneiaodeaOniaannmuluscineamupocdnceocuoirrrdaasdooenmaocdzbdE1aooiacvr3:noas5EfaludvoduIeiamd)carloiccahumlcsivaiaacedcytausanilicvcldloyoeiseanronp.Md.iacEaecdsotAnicamroopiclVmucadnanutrilnag.qsadpuuNooenEenrssiasccsbesso.l.tlpcuarcdLrecoia-nia(slnnEncicdlssciucogdcrlsriaiicactebiaidIntcnodou.nogdcaalecolrasroaPprnnpcrltusccaiclp-zcdoiaesenirnmdnstseiicncqcsntmucnprieacCecieisdnoncettnryreleare2zs)ig)acr,avrosdcsilaycsasnnrutfoscoesnhccdehaochnayusascarullltniqpludleuiacfmnceixrccsul Federal Court-Ordered Consent Decree. adversocnclbalancectnico/racialdelacscuclaquecnvlaorccibcalcstudianic.conformcaloquelasnormas SsichboloilngANDpriloirviitnyg iats gtihveensawmheenaddorneesschiwlhdenisthealraepapdlyicaetniroonlleids astubmtihtetedr.equested cd•sSeucbbeIlcncdcdceanp.vinvoinrdcandelalmlhsermmoadnoomidcciluino.cstudianicquevacstaasisucndoalacscuclaquescsolicna. Amboshcrmanos Uthheen chailcdhilwdilliscoenntrionluleedatmtenadiSnFgU,SD cphriilodrrietny'swilclentbeergiavndenthteo paarfeenetderindisccahtooels t•\Couacnlldaoccolncusntuuadriainaiscicssltiacnidnoscariltaomcinsmuan.asgcualreddcarritadpenlonDidsatrdiiaolEasccsocluacrlaUmqfuiecIacdcoordrccSsapnonFdreanacdilsccho,agyuuasrtdccdriian.daisc!aque fnootr btehegicvheinldrteon'fseedceerntesrchoaonld atsrsaingsnpmoernttastiownhenwiltlhebeOERpropvoirdteido.n (SPercitoiornityIII)wilils mpairsamoso.lisccitlaerpurnovccaemrbtidocdtcracnsscpuoclnae(esscccoclairo.nINIIj)j.scIcdartpnondadaulcscucla.sisc(Jenalapartecorrcspondicnic cPaormepnltest/eldegal guardians may request up to four (4) schools in Section III m e•sScappruocbdaednasuolniacidtcarlhaassclsaccuucaliarsoqcusecuhcalacss.coDgicdboc.nndoctpecnddriirlscdcsroclcahmocnalcapcalqaurc.llasquecstiustcddispucstoaaccptar Si the OER portion. They should only request schools they are willing to accept, •NucslroDistntoEscolarlicnclarcsponsabilidaddccolocaratodosloscsiudiantcs Cuandonoscpuedeaprobaruna when an approval is made for any of the four choices, an appeal will not be dclascscuclasqueustcdsclccclond.elDistriioiraurldcdeslgnaralcstudianicalplanicleducatlvoquelecorrcsponde accepted dcacucrdoasudomicilio. Dichadesignationschartdespucsdelperiodocnelquelasolicitudfuccnircgada. Sila AJgupulpayeradlisa2n0,swiwli1ll9l93.bbee asDecnceteapdtnleodmtiefoTinbclryatiaaofcntceerplteattnthceeerstihsniordAulgcauotsemtrput6t,ehranr1aA9n9u3dgousmatndp20r.opcaer1se9sn93ti./nlgegaoln du•ebCsiuciaagnrndaaotlicroscntcuindboiaaflnuaicccaucrnntaaudcnenolldaacsqculseocsuscccelnIactsrdeqcsuseicgscrcsuoclolagariccOss,cqupucueleaduseatscaudcchspletjlaoe,rcdtlaeiobdnce^rs.aigdncacciodmnplyctnaorsoytrdocsvoclovnctrinlauapracnmeosdciraabiaajnododcdcli . TsDahcidehsdotroerlsiSsca.tnplacFmeraTmayhenenctiassacsfsoiosgrinUgnanilmtlfehineetcdhsitlSuwdcdirheleolnnot.lbetDoimsUatthdhreeeincsatacfnhtoheoaOrlsERtaohfcehroaecissocspmeiopgnunstcmiaeenbrnnitoltirtfayobnredotomahpipsr/ppohrrveooervcdie,dseshiotnmhgeae acdicaon-rcduurmmtaeiqnnuutxecastohliaraoconegrDqlcusopeadnso;eauiamrenosneedicesoa.bJrosia?sail.caimeniscstoomo'l5.i)liui.cm'nozd.slrcrtaniqaneuljeegcsxiaresoajobidjncaslaeqqnuf^beeisreflaasJeSsem]ircuondaioxarcnatfae.jslnascekca2hscnj.uu£aceilpvaa.o-jc.eoZnrVrnZcsuLpeosn1sd1oi.e"Dn-it0sct.".£Ui?cjv.'alLn-o'd.ToB.'tl-todraidI: poweferiwohidlils/inhceorwnhtiiccnhhouiectehtseo,atprpytlhietcoatpmiaaorkneentwpal/salcegesamulebnmtgiutatfreoddri.aonneImfaoyftahtechceeapsOtEsRigtnchmahetonitcaesssw.aisgnmneontt oanned cDsucruacnltaehcalypacrsfidoodoapdrcopbraed-ainsLcraiptcarijdcniausdtccdlansovanccucrcussiudepbrcescinndiiacralracclonmsctsancyldaiadcenvaqcuuerulsa.sdEdssius sfcueprrocnscandtmairntisciuraanddaos.It . cUttophhneoetnpiorsrstemtucamdetaeiinrpotktn ooinffsliahtnpehe/sathoslesetittgihenserm.pEnndetuwcIaFltteoitTotHtneEhareS,lEDiPStshlTetaEcrPeipSmcaetrAneRtnEwti/tCNhOelTienqntaeFlrOfiLvLAgeNOuDWaErwDdoAirLakSnOiTnHgMEfUuSlA(TlP5)yPRrOeVtrdAuaeLrygnsisMIttLeohLfre Lcdneaoosmsdcovepbatlccairucaprmrudbuserecebtxaedincdgeicr1dlm9aas9i3ts)usbodcncrT:cauumnplbolairlnulc.oonm.ldiacclqlohnusaieebss.cntrotusrdcdiipealrbnectea(clddsiiczfaldtdccoeri.nkaei.rntmdoeisrsfycdrcpirruiunmyearcfligotracatdlaaonohd)oe.rbascarqrtuanemdpccilOctnsetn(uerdruibcadnloiclcax)ianmygcrpncaspcfclrasaiclsoa..ccsAlcsuclculaal(: BE CANCELLED AND THE CHILD WlTZ HAVE NdTfTTlTTEHETTT TO THE SpAClTLATER UstcdpuederccuTicarlaidcniincaci6nCtnica/raciaJdcsuhijounavcz.micnlrasest!iascritocnlascscuclaspiiblicas. . Wchuernrenttheimmupnairzenatt/iloengarlecorgdusardtioanincrleugdiestearsneghaitsi/vheerT.Bc.hiltde,st hwiet/hsihne onweillyearneeodf Sinisncerimpbtairognop,arcasidciccahmobai/olotendricfectocuandocomicnccclanoescolar siguicnte(1993-94)yqqduranteclpcrfododc school enrollment (September 8, 1993). kindergarten and first grade students mult il«o have a complete physical examination within a year. AprcciamossumicrcscnlascscuclaspublicasdcSanFranciscoydescamosquesuhijolengaunanoescolarUcnodccaiio' A parent/legal guardian may correct his/her child's racial/ethnic . identification one time while the student is enrolled in a public school. However, changes will be made for the following school year and not during an h m m m £ « b open enrollment period. We wish your child every success for the coming school year. 1992^ 11 380 *S' CH A H*t\a\ n« H«9u1«ngA1g«l,nt Ttgtpig.altgc /fc IB : Anlng lkalulu9od kung bibtssMn ntnyong mtbutl ang siwusunod n* Impormasyon tungkol s« 1993-94 w at*n14m»amawt^w 1993^ 1 199<^ bjjt aie a m k*ft srr- Piunang Pigptpal1sta/Para»«r«ing Pagpasok ia lb* II tUkitlkcUng Paaralan (OER). HOA OAPAT KA EQA.OK:indergarten: Iptnanganik ning o b«90 mag Ika-Z ng OlsyemOre. I9B8. •• V~)f<ift4I8B :; d£'*5'f*lj5hti 11998878J*>^i I122ffll 22aa aa22.W(TO HIfIJ ±£fVt) . . Unang Grado: Iplnangmik nang o bago nag og Olsyewbre. 1987 HGA KAILAXGAH SA 0H»S NAWG PACSUSULIT HG APUKASYQH: . K01agE1.p.a;p0.a(t3u)knaar'ydMednbiguchadalttresSkatstlKcrakogenarwsna'grnagnUmranagghualSanansgan/kg1yaa1angggau1lnaannyag/Htlaalkggiaanplaag-nnaagItCaaaglagia;fpoalrgln-hiaaala;agnag(-2()Kla)kgaalswllasurtkanunsylanyngagnsgraaesPlPabagogmHanmgUannPge.-hG.o i*fwB.uTR'<2>t^itfiiwcatioArmjnftwsiiA ij--i t&twiiot'ja«iwaxf«t:* .tn<i>ijom k « «^faAacianiA»W«ft»a/nsaBs kod Pangllpunan o Ibang ahenslyi ng paaahalaan sa aiguUng/l1ga1 na tagapag-alaga. Kung ang llstnslya skaatplabagymaanm.antho o I. 0. kard ay plnalltan sa loob ng nakallpas na (90) araw. kallangan ang pangalaoang i£<wui^aMfE*»seai^iifi. yra# n btnjuaaftmviiriSTjtiiia. . . Higpapituniy ng Petsa ng Kapanganakan tulad ng sertlplko. ulat ng ospltal, blnyag. o 'Medical Sticker*. MGA PANAHQH WG PAG-AAPtAT SIMULA KATAPUSAM SULAT SA HGA MAGULAWG Wife JLiL Uilnkkaaatnlgal«oaPnngagnaPhPaoannnaahhoonn 001411///013108///999233 000136///13151S///999233 LLLllInnnggggggooo nnnggg O00S37///001388///999333 11999923 If nIffll 31e8B 11999933 i^f I3f^l 3I1SBB 11999933 t*f. Sfl 83BB a«mW HA.8UM0aAkNaGkakIuMhPiQRnMgASnYgOaH apltkasyon sa lahat ng aga paaralan. sa bulxagan ng 13S Van Ness A»enue o sa Sentrong 1993 If 4fl 1a 1993 *F 671 1SB 1993 ^ 771 IBB 0\*l MagsusuM ng Paglalagyan sa Pag-aaral (E.P.C.J-135 Vin Hess Avenue. SII1d »1. . HknniuggnhdaOpiEaRaannragaslagtaaanpgkaadna-aaylnnngdgaapalganlagaaarnlakgnluannsngaannggta1ygnouponnalsaasunanmgadlnalagurnepsakaasnlaskhyaoooannpp.aynunlgtaeurUlrananahgnagnpkaasgaspaapbpaaauylnlasnntggappaaatngapMoaanprdaa1lalnsgrtlanp.aasaAuknnagaklaaatglaoyapakalgatnaastiaaxkaedkru*t-e *ROOIIM*1.5«jfrfaji*fiMiff«tSti*S5t]*IKf3lZlaIfWn-sM^vIant*ne«s»s*a4veAn«uejl|i»i8,ft13fsj£vaAn*ne*sRs*ave. . Ang aga pagtanggap sa hlnlhlMng na paaralan ay gagialn kung (1) aayroong bakante sa hlnthDIng n* grado (2) kung ang bllang ng nakallstang aag-aaral iy hlndt lalabag sa 1p1nag-uutos ng batas Pederal .. tAnKpnuauagnntggpukakloaaaolrrnyaaglpsaaaanHntgatanlnAbgaTabstaabnanaagatktaaaagntgklanaryapaslapaatuhsslnalada/kpakuaaupasglyaotknkauaratnisungulasassaudsenanhotnldraInos,hadllnlalgraalaennngskggesnluntyknarouanonngpngagsaaaprnpaagaoglmrkaabaInsakstiaanol(gaagopnagbna)antaSaihafytounSaIOyabanlglpabltulsmpgaagaapnuygagssstsuopoaskauantlrgnaUaatlaaaannsnggag.uglhaaalapnnplgllkhnatnasalylpaonanaga.gralan •• BHftttrtattHWtK-eftf&BtiBttMtt«t.niiBtlfftSctmfMejBfHSfsMltB»fSg»tsf.ijrBststtee.a^-iB*^*f!c*t!t!M.*r,asRt«ts.Pi«flij«k«Su.b?»*Ifi para s* sentrong panbata kasana ang Hbreng sasakyan. Hindi aalblblgay ang unang pagkakataon sa S-BaBSAHMrtjttHft£B*i>. jfnfl^B«/t;A«*WBB£HB4'4:. aga mkatakdang tatanggap na paaralan kung angbahag! ng "OER" (Sekslyon 111) ay slnagutan. . . Ang agi aagulang/lIgal ni tagapag-alaga lyaaaarlng huntling ng hanggang apat (4) na paaralan «wwBXB*«iaB^ sa Sekslyon 111 ng bahag! ng OER. Ang nga paaralan laaang na handa nlnyong tanggapln ang dapat hlMngln. . Ang agapag-aplla ayaaaarlng tanggapln laaang pagkatapos ng pangatlong pasutulang pagptH ng Bft' ^ttEBAitBBABBWBHTirteBjJiiarlEgnDBW. il»n-SRfll1 koapyuter na gagaoln sa 1ka-20 ng Hulyo.1993. Ang katapusang araa ng pagtanggap ng pag-aplla ay Ilkaal-aa0p6asngngAg1oksat-o20.19ng93Agaotstaon.g19s9a3g.ot ay Ipadadala sa nga raagulang/1Igal na tagapag-alaga nang hlndl I«Mf0t».BB*MHWttBH*BBS*#Wi* . T•Un/uygrUnaghgahalkpalnulndll.llknnaansAyanntoagganpg.rSpauFapbUgaKaStughOan-agtannal.akaadgnabagalaagnapaygyaargnlgtHnaalgngtngaaavaktnpldaganakadrPpaaauayrlngoagkhknlintpdaaaalnnpaggorsa1allsaanaagnghtasatapaktadnnkagaaahnnaollsganynaagannaggbagaa-taptaaguaa.ahsrauaKnnplugatnnlglaaIlynplogaa,nnggppsaaaaantgaeuppaklllraodllnylnlnygsagaanngtgpkaapondaaaglrgpgralyaelaupsaltllnneayrgosannagpya"napggOaakEgarRusa"lualnlgt 2tIWi»Nt»lr-2»*BKB*)f*5«tFMl.«.t^^*lB*nS«*Bkr'MiHBeo-gBrlfiAaCJBj»lAB.Bt<82.t*BlW9BB9-WB3MBB*.B4AJS*J.ifW5K*f8'1M»f9t5i92^F«03^fU*BClc1Bl0T7Ar7qs1eUi«:iiAeJt*»ata.WBfWf»1«I60BlW5lBKBaS<1-•^192M^H9.3nWB^lirkBT8iif(l£lB6S1S6 a sa ||| sa aga plnlll sa 'OER*. . aPaaanggg-kabaaatrhaaanlgglgakpnugnngglslllhylaahaaanaayn*nbaanggapogatppaaattlauwknadanay.gsakslaEnPaPCkuarloatlkangsgiaaynolgnoobdIibnanlgldkaHpaakataniggkaoda(pS)nlgetaauraahg»lunlnaaanngag/aypIaIgtgaprlaabpniaahlolsttnagagaaspaaargk-aalaga «H^Kn^t»t«»BI»B»Bei»«»itf«2tim)«ii)idaf3Rtvf»tifU«1t3».ijB»:rfBt»-BB'^6JA«««iB2CB.BBA«£>BBtEBBfttoB(s£1a^aviae«±^»aBBliUsl^B^ljHjAu nAgT kPoArGeKyAoTAPsaOSlAlHhaGa.BAKTAAPAAGT AMJAIWGAWHAALKA8HAHGNGHAKAR[ATOPATATANHlShADILU6WAARSUHHO1OY.A MSAAMAPAMAARCAALWAGN.BISA ANG PAGKAKAAPRUBA s«*k««.'Itt&irtti^iLfBRBADB*IBfl^WB*WAifBl.»»B.IJemEwPumtn.WmitEBsitat.dmB±^BtHa»tJti-J^iwlt»r.ju.wKT . uSalatpagnpgapnaelglasttlabonngg braetsaultaangngaagbualkaunnga/sIaIgaTl8 nsaa ntaasgaaspaakgu-paalnagangayIskaangllatnaognangngnapgadgpaalpaalnlgstkaasaslaupkauayraanlgan iBSliMdBBf.l^SB U993 «F 9fl BB^ffJi iblt[llft-«paWB•^£«iflB-^r»j6'JUIX k(o1akpal-8etonnggSpetaygtsaubsrueM.ng199p3a)n.gkAantga«aagnasakinndaesragsaarktuepnanatngunHaanngggrtaaodno.ng aag-aaral ly kallangan din ang **> ^tfcCB A bj K»ItntF fcfflttfi' KB-^C 3U* M ABM ^tttt'JB . Isang beses laaang aaaarlng aagpalH o Haaa ngaagulang/1Igal na tagapag-alaga ang pigkUllinlmg lahl/kultura ng bati habing angaag-aaral lypumipisok si Hmg paaralang paapubllko. ar^aB^iciiE^ajBijB^^iiB/a*. Oatapwat. angaga pagpapallt ay aagigma laaang sa loob ng nasasakupan ng taong paapaaralan at hlndl sa panahon ng pagpapalHtahan. Hlnahangad naaln ang baoat taguapay ng Inyong anak sa daratlng na taong paapaaralan. JOtCE A: COBLE'. DIRECTOR EDUCATIONAL PLACEMENT CENTER f 6 JANUARY 1993 pagcwecklypublishedbySamuel Bran- MONTH nan. In 1849,San Franciscoestablished III! itsfirstbank, theExchangeand Deposit The Puzzler In San Francisco Office located on KearnySl In 1857, a 4 * 7:45 3.m. earthquake and aftershocks HISTORY shook San Francisco, with shocks Anne K»mrrunm bn reportedlyfeltasfarawayasSan Diego. Jan. 16: In 1865, brothers Charles HAPPY NEW YEAR and Michael H. DeYoung published WORD LIST the first issue of the Daily Dramatic RESOLVE (To be. .do) LOVING . Chronicle, a free theatre newspaper GENTLE Jan. 1: In 1954, Alcatraz Island, whichsoongrewinto today'sSan Fran- formerly a military post, became a DILIGENT p A s I N C E R E W N C Fcder.il Prison. ciscoChronicle. PRODUCTIVE Jan. 22: In 1850, theAlta California, HONEST u R u 6 F R I E N D L Y Jan. 2: In 1921, De YoungMuseum, formed by the merging of the Califor- TENACIOUS nowapartoftheAcademyofSciences, nian and California Star, the first two ASSERTIVE N H o N s E T s E N 0 H opened in Golden Gate Parle newspaperspublished inCalifornia, be- HPUUMNBCLTEUAL c K I D H A P P Y G V E menJacne.d5:onInth1e933G,olcdoensntrGuaclteionBrciodmg-e wchaemen itthsewisttacthee'ds ffirrostmdiatislyprneevwiosupsapterir- PATIENT T S c I U T F W E N H V when a crew began excavating for the weekly schedule. In 1939, the Aquatic MarinCountyanchorage. Park, adjacent to Fort Mason in the GRACIOUS FRIENDLY U M A L M C H N A I U I Jan 8: In 1880, Joshua Norton, a northern part of the City, was officially onetime successful City businessman, dedicated. SINCERE A I R I B A T U R V M T died. When ill-fated grain speculations Jan. 27: In 1894, the Midwinter Fair, HUMOROUS left him penniless, Norton declared a City event which publicized the CALM L L G G L L 0 I G 0 0 R himself Emperor of the United States Pacific Coast's mild off-season climatic SAFE A E R E E M S u V L R E andProtectorofMexico,issuedhisown conditions, opened in Golden Gate SMILE currencywhichwas sympathetically ac- Park. In 1955, a severe landslide per- HUG E I V N D R E A M E 0 S cepted by local shopkeepers, and went manentlycloseda stretch ofEl Camino DREAM on to become one of San Francisco's del Mar, a scenic drive near Land's HAPPY H P A T I E N T F 0 U S mostcolorful oddball characters. End. NEW Jan. 9: In 1847, San Francisco, then Jan.30: In 1847, theCity's namewas YEAR S U 0 I C A N E T E S A known as Verba Buena, issued its first officiallychanged fromYerbaBuena to newspaper, the California Star, a four- San Francisco. ARTHRITIS SELF-HELP COURSE tors; howtoexercisewith arthritis; and The Arthritis Foundation will be how to solve problems caused by sponsoringArthritisSelf-HelpCourses arthritis. TheyWere San Franciscans busiestbankinghouse in thetown. waASthIPptionneaoeanarisrrldnetTmnttpleha;eihadMfByecdf-aenheaoielwrnyonpcuaisA.itsadwdrtienbtletvteli1oo1tehsnt9cfo2hlrtC9aly-Saiybe3toeatmveer.iuacineaasocrnsorttnnnotesasmaSnupi,hmegrsCeetooluoeershfwvlwnmur-imelbziettHoeere,ncoheddugta1liMbgiyi0ptcehnono0ateponnCu,tttruiht0oreiwiont0reousiagg0nrrtmrtcrsthiesphao;haneeyeunrmdoirFhaBatopiseoisgnaclebtswe-de.ay.o. 4wTasaAHfmF6hbenirheea4ilboteeley-peArtshkp6sonhfrs2bmftseaei4yoyoioearr0tragoen.nlicitkabd-gnosahydyicvvempualaae.aec,FluinrreodltodeaoetuuTtbsrrswhglfnhsueieeafdealentolnctaefvrhoyocertao2eaportir.laruyhyhorelrooptlfoynsPsauhafr,erlerrtuotetiesnwimalthdadaheiseloseseacotn,ArcossraecnchattSalfhdrlh3swooulie[ir0erlp8tti.neea0tuit0sok0rhsio0ti]-t.es.,nox abhbtMhrreoneoeaatfdnwmnBnMhooaWesosrarsmpprWteIinobeahnnrhcyeeyLgtueroiolinOnihLanhuthnitgiBenliIigmusirgvipto>ieflA2WeocntooiorlsagrMilpeSnhnarllheradiknieiaennssaRowrtMamndfFoinAfPinrsResdnlesaeaahaLiynslnilsgcmscpsspSi.ooijstiasuaoupocrnTltsdpnoatthsiw.vinO,i"aifesRazgirNOaciaeash"rvdrthtiToediiioshrtrnilp,ssegyne vlmcorPghp1yeiachaoa8ravritca7zekSiRrea2museseenl,oacipedirgaeslindbiesfSeeeeroOtHtodnaswuguoonrotnnsthacnebe$nebooflFyu4emnain.rot4pgpnsofa0aaotiresn,nnhnltnuhc0uceailmiii0mskoeacors0Meelldocridfddonloessopflfpshrrroastootaaeoar'shfnrpmfibpetudeietoilhrrcxsocsaepeswt,htwotnmtiiia-sfannsitourtdovhgrtansereieetotsocnshe,miiwiieftoelsrvnnofnnueisgbgrpttxssoasttusaaionihhrbtroitlneke--o-yenf pendent Party, quite impressedwith his the rugged ibthmus jt Panama. bank'stemporaryclosureonAugust27, Mayors ofSan Francisco strong stand against the threatened First arriving in San Francisco on 1875. known since then as "Black 1 strangleholdofthe railroads. September 20. 1851. Ralston stayed for Friday" by local businessmen. Mills JAMES OTIS Nominated as the party's mayoral good in 1854 when he and a partner would later come out of retirement to candidatein 1873,Otiswonacloseelec- becameagents forsteamers byforming reorganize and reopen the Bank of When William Atvord was mayorof tion, takingofficeon December L the Accessory Transit Company. In California,resuminghisoriginalpostas San Francisco, hisdesiresforchildren's During his term, Otis was quite January, 1856, be and three other president. housing and an expanded police force adept in making his feelings known of partnersopened a bankinghouse. Rattled, but still in optimistic spirit throughofficers'salary reductions met rhe then deplorable state of the City's Alongwith businessman D.O. Mills, thedayafterhisbank'sclosure, Ralston withgreatresistancefrom City officials streetsandsewersystem,adesirewhichI Ralston helped establish the Bank of went for his usual swim in the bay off questioningwhat they thought was im- stemmed from his fear of plague. San California in 1864. the first incor- Hyde St. never to return to dry land. practical ideology, despite the rapidly Francisco was also experiencing grow- poratedbankin thestate. Mills became Hisaccidentaldrowningattheageof49 .growing local population. Such inganti-Chinese sentiment, as many of bank president, and Ralston served as sadlyoccured justfiveweeks before the A negativity, coupled with Aivord's im- the townspeople seemed convinced its first cashier. branch office was gala opening of the Palace Hotel on mense interestin avariety oforganiza- thatthe newwaveofworkingmen from eventually established in bustling Vir- October3. tions in which he participated com- the Orient was depleting the local job' ginia City, Nevada at the height of the RalstonSlintheCity'sInglesidedis- pelledhim todeclineseekingreelection market at considerably reduced wages. bigsilverbonanza, soon to become the trictisnamed in his honor. in 1873. He insteadendorsed the selec- Some citizens even went so far as to tion of fellow City businessman James createaWorkingman's Party, nominat- GRAPEVINE CROSSWORD #1 Otis. ing Andrew Bryant as their mayoral Born in Boston, Massachusetts on candidate in 1875. ACROSS August 11. 1826, Otis firstworked as a Not wishing to go against the grain, 61.. CTreoxstsure mercantile clerk before jumping at the Otis planned to complete his two-year 10. Ancient offertobecomeapartnerofaSan Fran- term and return to the importingbusi- 1121.. PPreotmrionleenutm ciscofirm. Arrivingin the BayAreaon ness, but he never got the chance. He 16. Adhesive wAiutghusthte23F,.W1.849M,aOctriosnsdpaeynt&thCroeempyeaanrys cdyaimneg dinowonffiwciethondipOtchteoribaerin30t.he18f7al5l., 211198... ARSneoyvuitshoeneDakota importinghousebeforeleavingtheCity Afterconveninginaspecialsession,the 22. Twice five toreturn forgood in 1858to reacquire Board of Supervisors voted to appoint 2235.. BEolletvated train his partnership and marry the boss's Supervisor George Hewston to com- 26. Molar daughter. plete the month Otis had remainingof 27. Air motion Elected to the S.F. Board ofSuper- his term. 2290.. NSoorutthheaDsatkota visors in 1859, both bis political and OtisSL,namedtorthefirstSanFran- 31. Therefore bmuasdienemsasndyeapleionpglseolvaekretnhoeten,exetspdeecicaaldley jcaicsceontmtaoyoMrisstioodnieSt.inboeftfwiceee,nrDuunsboacde- 333245... EFSoxcoiolsrtn the newly forming People's Inde- St.andSouth Van NessAve. 37. You 39. Pontif 40. Except 11. Again 12. Quality we serve with honesty & dependability 45. Bromine FOR YOU - we buy, sell, trade, 4468.. MCursuisctaalceahnigh rent, manage 49. Writing liquid 52. Dog 53. Shades HENRY 54. Docile SCHINDEL 13. Aboard 35. Substantive Real Estate Broker DOWN 1154.. EEnxcpoiuartaege 3367.. DYoruinking vessels SOLUTION 1. Dweller 17. Application 39. Establish 91 Leland Avenue 239-5850 453... SEFdnuiontwcitoivnoenhicle 222024... BPLiriremdsietnetd 444534... BOPacatcsutrtime NEXT ISSUE San Francisco 94134 6. Proceed 28. Mechanical man 47. Metal 7. Proper 31. Over 49. Golf peg 8. Whole 33. Europium 51. Kansas 34. Accomplish 52. Colorado