TheISMEJournal(2015)9,2078–2093 ©2015InternationalSocietyforMicrobialEcology Allrightsreserved 1751-7362/15 www.nature.com/ismej ORIGINAL ARTICLE The diversity and host interactions of Propionibacterium acnes bacteriophages on human skin This paper has been corrected and a corrigendum also appears in this issue Jared Liu1, Riceley Yan1, Qiao Zhong1,2, Sam Ngo1, Nathanael J Bangayan1, Lin Nguyen1, Timothy Lui1, Minghsun Liu3, Marie C Erfe4, Noah Craft4, Shuta Tomida1,6 and Huiying Li1,5 1Department of Molecular and Medical Pharmacology, Crump Institute for Molecular Imaging, David Geffen School of Medicine, UCLA, Los Angeles, CA, USA; 2Department of Laboratory Medicine, Suzhou Municipal Hospital, Suzhou Hospital Affiliated to Nanjing Medical University, Suzhou, China; 3Department of Microbiology, Immunology and Molecular Genetics, David Geffen School of Medicine, UCLA, Los Angeles, CA,USA;4LosAngelesBiomedicalResearchInstituteatHarbor-UCLAMedicalCenter,LosAngeles,CA,USA and 5UCLA-DOE Institute for Genomics and Proteomics, Los Angeles, CA, USA Theviralpopulation,includingbacteriophages,isanimportantcomponentofthehumanmicrobiota, yetispoorlyunderstood.Weaimtodeterminewhetherbacteriophagesmodulatethecompositionof the bacterial populations, thus potentially playing a role in health or disease. We investigated the diversity and host interactions of the bacteriophages of Propionibacterium acnes, a major human skin commensal implicated in acnepathogenesis. Bysequencing 48P.acnes phagesisolated from acnepatientsandhealthyindividualsandbyanalyzingtheP.acnesphagepopulationsinhealthyskin metagenomes, we revealed that P. acnes phage populations in the skin microbial community are oftendominatedbyonestrain.Wealsofoundphagestrainssharedamongbothrelatedandunrelated individuals, suggesting that a pool of common phages exists in the human population and that transmission of phages mayoccur between individuals. To better understand the bacterium–phage interactions in the skin microbiota, we determined the outcomes of 74 genetically defined Propionibacteriumstrainschallengedby15sequencedphages.DependingonthePropionibacterium lineage,phageinfectioncanresultinlysis,pseudolysogeny,orresistance.IntypeIIP.acnesstrains, wefoundthatencodingmatchingclusteredregularlyinterspacedshortpalindromicrepeatspacersis insufficient to confer phage resistance. Overall, our findings suggest that the prey–predator relationship between bacteria and phages may have a role in modulating the composition of the microbiota. Our study also suggests that the microbiome structure of an individual may be an important factorin thedesign ofphage-basedtherapy. TheISME Journal (2015) 9, 2078–2093; doi:10.1038/ismej.2015.47; published online7April 2015 Introduction (Rohwer and Thurber, 2009) and regulate both the abundance and diversity of their bacterial hosts by Thehumanskinisinhabitedbyhundredsofmicrobial predation (Suttle et al., 1990; Waterbury and Valois, species, including bacteria, fungi and viruses. The 1993; Rohwer, 2003; Rodriguez-Valera et al., 2009). homeostasis of this ecosystem is important to its Although the skin bacterial community has been functionasabarrieragainstinfectionandcolonization studied by several groups (Gao et al., 2007; Costello of pathogens on the skin surface. Bacteriophages et al., 2009; Grice et al., 2009; Kong et al., 2012; are important components of the human microbiota. The Human Microbiome Project Consortium, 2012; They are a reservoir of diversity-generating elements Blaseretal.,2013;Fitz-Gibbonetal.,2013;Nakatsuji et al., 2013), relatively few studies have character- ized the skin viral community (Foulongne et al., Correspondence: H Li, Department of Molecular and Medical 2012;Maetal.,2014;Wylieetal.,2014).Inparticular, Pharmacology, Crump Institute for Molecular Imaging, David Geffen School of Medicine, UCLA, 4339 CNSI, 570 Westwood thecompositionanddynamicsofbacteriophagesand Plaza,Building114,LosAngeles,CA90095-1770,USA. theirinteractionswithbacterialhostsontheskinare E-mail:[email protected] not well understood. 6Currentaddress:DepartmentofGenomeBiology,KinkiUniversity, The microbial community in the skin pilosebac- Osaka,Japan. eous unit is dominated by Propionibacterium acnes, Received 9 October 2014; revised 12 February 2015; accepted 26February2015;publishedonline7April2015 which accounts for nearly 90% of the microbiota P.acnesphagepopulationintheskinmicrobiota JLiuetal 2079 (Fitz-Gibbon et al., 2013). Although P. acnes is a On the other hand, bacterial hosts can influence major skin commensal, it has been considered a phage populations through antiviral mechanisms, pathogenic factor for acne vulgaris (Leyden, 2001; such as the restriction modification mechanism and Bojar and Holland, 2004), one of the most common the bacterial adaptive immune system utilizing skin diseases affecting over 80% of adolescents clustered regularly interspaced short palindromic and young adults (White, 1998; Bergler-Czop and repeat (CRISPR) sequence arrays (Horvath and Brzezin´ska-Wcisło, 2013). Our previous 16S ribosomal Barrangou, 2010). In our effort to characterize the RNAmetagenomicstudydemonstratedthatP.acnes straindiversityofP.acnesinthepilosebaceousunit, strain population structure in pilosebaceous units we discovered that all sequenced type II P. acnes differs significantly between acne patients and strains harbor Type I-E CRISPR and CRISPR- healthy individuals (Fitz-Gibbon et al., 2013). associated (Cas) proteins (Fitz-Gibbon et al., 2013; Certainstrainsarehighlyassociatedwiththedisease Tomida et al., 2013). Marinelli et al. (2012) (Lomholt and Kilian, 2010; McDowell et al., 2012; suggested that the CRISPR mechanism explains the Fitz-Gibbon et al., 2013; Tomida et al., 2013), while resistance of certain P. acnes strains to phage some strains are enriched in healthy skin (Fitz- infection, yet noting that some of their observations Gibbon et al., 2013). were inconsistent with this theory. In parallel, P. acnes phages are dominant bacter- Tobetterunderstandhowbacteriophagesmodulate iophages in the pilosebaceous unit (Fitz-Gibbon the bacterial composition of the skin microbiota and et al., 2013). It has been known for over 50 years their potential roles in skin health and disease, in that P.acnesphages exist onthe humanskin(Brzin, this study, we determined the diversity of P. acnes 1964). They have the morphology of siphoviruses, phages and their interactions with bacterial hosts in consisting of a ~50nm icosahedral head and a theskinofacnepatientsandhealthyindividuals.We ~150nm flexible tail (Farrar et al., 2007). Zierdt sequenced the genomes of 48P. acnes phages et al., (1968) isolated phage 174 from spontaneous isolated from 37 individuals and investigated plaques of a P. acnes isolate. Phage 174 was able to whether certain phage strains dominate the skin lyse nearly all P. acnes strains tested in the study. microbiota. By analyzing the skin metagenome data Subsequently, more P. acnes phages were isolated, from the Human Microbiome Project (HMP), we which exhibited lytic as well as pseudolysogenic further verified our conclusions from analyzing behavior (Lood and Collin, 2011). However, in the sequenced phage isolates. We also challenged a past decades, the study of P. acnes phages had been panel of 74 genetically defined Propionibacterium limited to the development of phage typing systems strains against 15 of the sequenced phages to to distinguish different serotypes of P. acnes determine the outcome and mechanisms of their (Jong et al., 1975; Webster and Cummins, 1978). interactions. Recent sequencing of 14P. acnes phages (Farrar et al., 2007; Lood and Collin, 2011; Marinelli et al., 2012) suggested that they have limited genetic Materials and methods diversity with over 85% nucleotide identity in the genome. All sequenced genomes are similar in size Phage isolation and DNA extraction and structure with 45–47 genes encoded in two Skinfolliclesampleswerepreviouslycollectedfrom oppositely transcribed regions named the left arm the nose of acne patients and individuals with and right arm (Farrar et al., 2007; Lood and Collin, healthy skin as reported in the study by Fitz- 2011; Marinelli et al., 2012). Gibbon et al., (2013). To best represent the diversity Much is to be learned about whether bacterio- of populations and history of medical care, the phages drive the diversity and dynamics of the skin subjects were recruited from private practice, man- bacterial community. The ratio between P. acnes aged care and public hospital settings, as well as phages and P. acnes was ~1:20 in pilosebaceous outsideofdermatologyclinicsinSouthernCalifornia. units,basedonapooledhealthyskinsamplethatwe Written informed consent was provided by all study analyzed previously (Fitz-Gibbon et al., 2013), but subjects. canvaryinalargerangeamongindividualsandover Thefolliclecontentscollectedonthesurfaceofthe time. P. acnes phages do not encode integrases in nose strip were mashed using a sterile loop (Fish- their genomes (Farrar et al., 2007; Lood and Collin, erbrand, Pittsburgh, PA, USA), and plated onto a 2011), suggesting their inability to stably integrate blood agar plate (Teknova Brucella Agar Plate with into the host chromosome. They can kill the host HeminandVitaminK,Teknova,Hollister,CA,USA). bacteriathroughcelllysisorcanenterapseudolyso- The sample plates were incubated at 37°C for genicstateinthehoststrain(LoodandCollin,2011), 5–7daysanaerobicallyusingtheAnaeroPackSystem in which the phage DNA persists in infected cells (Mitsubishi Gas Chemical Company, Tokyo, Japan) withoutlysingthehostorintegratingintoitsgenome. (Fitz-Gibbon et al., 2013). Whether P. acnes phages modulate the relative Phageplaquesobservedonthecultureplateswere abundancesofdifferentP.acnesstrainsbyselectively isolatedby puncturingthe agarwith asterilepipette killingspecificstrainsofP.acnesandthusplayarole tip and resuspending each tip in 50μl SM buffer in skin health and disease is unknown. (0.1M sodium chloride, 8mM magnesium sulfate TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2080 heptahydrate, 1M Tris-HCl, pH 7.5, 2% gelatin and determiningtheoverlappingintervalsbetweenallof 1mM calcium chloride). Each phage resuspension the 61 coordinate sets. The core region sequences was spread onto A-media plates (12gl−1 pancreatic were concatenated for the subsequent multiple digest of casein, 12gl−1 yeast extract, 22.2mM sequencealignments.Singlenucleotidepolymorphisms D-glucose,29.4mMgl−1potassiumphosphatemono- (SNPs) in the core regions were identified by using basic, 8mM magnesium sulfate heptahydrate and 20 the ‘show-snps’ option of Nucmer with the default gl−1 agar) with top agar containing P. acnes strain setting.Inaddition,thesetofnon-synonymousSNPs ATCC6919. After incubation at 37°C for 2 days, was obtained by masking the third codon positions single plaques were selected and propagated using in the coding regions. Using MEGA5 (Tamura et al., the same host strain, medium and incubation 2011), phylogenetic trees were constructed by the conditions. Suspensions of each phage isolate were Neighbor Joining method from p-distances based on prepared by eluting plates with 8ml SM buffer at all SNP sites in the core regions or only the non- roomtemperature,filteringwitha0.22-μmPESfilter synonymousSNPs.Bootstrapping wasperformedon (Millipore, Billerica, MA, USA) to remove bacterial 1000 replicates. cells, and storing at 4°C. Phage titers were deter- mined by plaque assay. Analysis of nucleotide polymorphism within single Phage DNA extraction was performed using the phage strains Lambda Mini Kit (Qiagen, Valencia, CA, USA) with The genetic variation within a phage strain was the following modifications. Phage particles were measured by the number of SNPs found in the precipitatedinBufferL2bycentrifugationat20000g sequencingdatafromaclonalphagepopulation.The at 4°C for 1h. Extracted DNA was precipitated SNPs were identified as sites in a strain’s genome overnight at −20°C before centrifugation. assemblythatwerecoveredby⩾30readswithPhred quality score ⩾30 and with ⩾10% of these reads Phage electron microscopy differing from the consensus sequence. Copper grids (400 mesh formvar per carbon film) (TedPella,Redding,CA,USA)wereglowdischarged. Analysis of metagenomic shotgun sequencing data of Phagecultureswereapplied,followedbyawashwith 0.22-μm-filtered water. The samples were stained the skin microbiota Phage diversity was analyzed in the metagenomic with 1% uranyl acetate and examined under a JEOL shotgun sequencing data from 27 retroauricular JEM-1200EX electron microscope (JEOL, Peabody, crease samples collected in the HMP (The Human MA, USA) with an accelerating voltage of 80kV. Microbiome Project Consortium, 2012). The SRA accessions of these samples are SRS013261, Phage genome sequencing, assembly and annotation SRS024598, SRS013258, SRS024596, SRS019016, Phage genomes were sequenced in multiplex using SRS019015, SRS019033, SRS019063, SRS019064, the Roche GS FLX Titanium (Roche, Branford, CT, SRS019081, SRS024655, SRS024620, SRS020263, USA) or the Illumina MiSeq (Illumina, San Diego, SRS020261, SRS017851, SRS017849, SRS057083, CA, USA) platform. Sequence reads were initially SRS024482, SRS045606, SRS058221, SRS018978, assembled using MIRA 3.2.1 (Chevreux et al., 1999), SRS058182, SRS016944, SRS046688, SRS015381, and the resulting contigs were manually finished in SRS052988andSRS019116.Accesstothephenotype Consed 23.0 (Gordon et al., 1998). Some phage data for this study (phs000228.v3.p1) was obtained genomes required additional PCRs and amplicon from dbGaP. MIRA (Chevreux et al., 1999) was used sequencing to fill the gaps between contigs. Fully to identify phage reads in each data set by mapping assembled phage genomes were annotated using against the P. acnes phage PA6 genome. Parameters Genemark.hmm (Lukashin and Borodovsky, 1998) similar to thedefaultwere used: ⩾20 ntoverlapand and Glimmer v3.02 (Delcher et al., 1999) with ⩾60% identity. To estimate the number of P. acnes manual corrections. All phage genome sequences phage strains in each data set, we first performed have been deposited in GenBank under BioProject a de novo assembly using the extracted phage reads PRJNA173665 with accession numbers JX570702- from the metagenomic data. We then aligned all the JX570714, KJ578758-KJ578792. phage reads to the resulting contigs to identify SNPs in the core genome regions. The assemblies and alignments were manually inspected using Consed Genome analysis and phylogenetic tree construction (Gordon et al., 1998). The same criteria used for Sequences present in all 62 phage genomes were nucleotide polymorphism identification in single defined as core regions of the phage genome. To phage strains were applied as described above. identify these core regions, we first generated alignments between the PA6 genome and each of the other 61 phage genomes using Nucmer (Kurtz Analysis of phage genes under diversification et al., 2004). This yielded 61 sets of starting and Multiple sequence alignments of Group VI and ending coordinates describing intervals within the Group VIII phages and their related phages PA6 genome that align with a given phage genome. (PHL037M02 and PHL073M02) were generated Wethencalculatedthecoreregionsforallphagesby using MAFFT (Katoh et al., 2002). The positions of TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2081 all mismatches and gaps were recorded. Sites The PCR was run under the following conditions: of discrepancy were plotted in Artemis (Rutherford initial denaturation at 94°C for 5min, 35 cycles of et al., 2000). denaturation at 94°C for 45s, annealing at 53°C for 35s and extension at 72°C for 1min, with a final extension at 72°C for 10min. Propionibacterium culture P.acnesATCC6919cultures,whichwerere-grown P.acnes,P.humerusii,P.granulosumandP.avidum afterlyticinfectionwithspecificphages,weretested strains were cultured under anaerobic conditions in forsuperinfectionimmunitybypassagingsequentially Clostridial Reinforced medium (Oxoid, Thermo two to four times without further phage infection. Fisher Scientific, Waltham, MA, USA) at 37°C for Phage resistance was assayed using the same cross- 4–6 days. Propionibacterium cultures were used to streak method described above. The presence of prepare top agar overlays for phage culture on phage DNA in re-grown cultures was determined by A-media plates. PCR using the primers targeting the phage gp11 gene (Forward 5′-GGCTGGAACACGTAAAGCG-3′, Reverse 5′-CACGATCGATCAACTCAACC-3′). The Phage resistance test PCR was run under the following conditions: initial The resistance/susceptibility of Propionibacterium denaturation at 94°C for 5min, 35 cycles of strains against phages was determined using denaturation at 95°C for 45s, annealing at 58°C for a modified cross-streak assay. Fifteen of the 48 35s and extension 72°C for 1min, with a final newly sequenced phages were randomly chosen for extension at 72°C for 10min. theanalysis.Twosetsofphagesthateachbelongsto the same group, PHL010M04 and PHL066M04 in Group VIII and PHL115M02, PHL085N00, and PHL085M01 in Group VI, were included. The CRISPR analysis bacterial strains were streaked across in A-media CRISPR spacer sequences were previously identified plates, along with ATCC6919 on the same plate as inP.acnesgenomes(Fitz-Gibbonetal.,2013;Tomida acontrol.Approximately 5μlof106PFUml−1phage et al., 2013). The spacer sequences were aligned suspension was spotted onto each bacterial streak. against all phage genomes using BLASTn. Protospa- The plates were incubated at 37°C anaerobically for cers with up to two mismatches were identified. 2 days. At least five replicates of each cross-streak experiment were performed to determine whether the strains were susceptible or resistant. Results For the strains that showed resistance in the Phage isolation and genome features modified cross-streak experiment, we further In an effort to determine the diversity of the skin quantitatively determined the resistance by assaying microbiota,wepreviouslycollected203skinsamples the efficiency of plaquing of the phages relative to from 179 individuals, including 94 samples from P.acnesstrainATCC6919,calculatedasthefollowing: acnepatientsand109samplesfromhealthyindividuals 1 with clear skin (Li, 2010; Fitz-Gibbon et al., 2013). ¼ Resistance Twenty-four individuals were sampled twice over a Efficiencyofplaquing 4–6 month period. When we cultured the skin ¼ TiterofphagestrainXonATCC6919 samples for bacteria, we observed phage plaques in TiterofphagestrainXonbacterialstrainY 49 of these samples: 14 from acne patients and 35 from healthy individuals. P. acnes phages were We considered a 100-fold or greater increase in efficiency of plaquing to be evidence of resistance. found more frequently in samples from healthy individuals than from acne patients. Our rate of The plaques on cross-streak plates were visually phage detection (24% of investigated samples) is inspected by one person and scored for turbidity similartothosepreviouslyreported,rangingfrom26 based on the re-growth of the bacteria after plaque formationusingthefollowingscale:0=clear,1=little to 30% (Marples et al., 1973; Puhvel and Amirian, 1979). The phages that we isolated have the to no re-growth, 2=mild re-growth, 3=moderate morphology of siphoviruses as previously described re-growth and 4=heavy re-growth. The average plaqueturbidityscoreofallthestrainsfromthesame (Farrar et al., 2007). A representative electron micro- graph is shown in Supplementary Figure S1. Among P. acnes clade was calculated for each of the tested the phage isolates obtained from these samples, we phages and was compared among different clades. selected 21 phages from acne patients and 27 from healthy individuals for whole genome sequencing Pseudolysogeny characterization using 454 or MiSeq platforms (Supplementary PCR was performed on phage suspensions using the Table S1). In some samples, multiple phage plaques primers annealing to the ends of the phage genomes wereisolatedandselectedforsequencing.Allphage (Forward 5′-CCGAAGCCGACCACATCACACC-3′, genomes were assembled, completed and annotated Reverse 5′-TCATCCAACACCTGCTGCTGCC-3′) to (Supplementary Figure S2). A representative phage determine whether phage genomes are circularized. genome is shown in Figure 1. TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2082 The P. acnes phage genomes are highly similar to not used in the genome assembly process. We eachother(SupplementaryFigureS2).The48phage identified the nucleotide positions with a minor genomes have comparable sizes (29.0–29.8Kb) and allele frequency X10% and covered by at least 30 GC contents (53.7–54.5%) (Supplementary Table reads with Phred quality ⩾30. We found that each S1). The sequence identity between any pair of phage genome contains 0–11 polymorphic sites genomes ranges from 85.2 to 100%. On average 45 (Supplementary Table S1). The number of poly- openreadingframeswerepredictedineachgenome. morphisms in each assembled genome did not Consistent with previous reports (Farrar et al., 2007; increase beyond 11 sites despite the large numbers Lood and Collin, 2011; Marinelli et al., 2012), these of sequencing reads obtained (up to 9120× genome open reading frames were arranged compactly coverage). From this analysis, we conclude that the within the left and right arm regions of the genome background level of genetic polymorphism within a (Figure1,SupplementaryFigureS2).Ouranalysisof clonal P. acnes phage isolate is ~11bp. Thus, phage the 48 new phage genomes supports the annotation isolateswithasimilarorsmallernumberofnucleotide of the gp22/gp23 locus as a single open reading differences throughout the entire genome can be frame (495 to 522bp) on the minus strand considered as belonging to the same phage strain. (Supplementary Figure S2). This is different from Sincethephageswithineachgroup(I–IX)differbyat previous annotations based on a small number of most 14bp (Supplementary Table S2), they likely genomes(Farraretal.,2007;LoodandCollin,2011). represent clones of the same phage strain. Phylogenetic relationships among the phage genomes Diversity of P. acnes phages in the human skin To determine the genome diversity of P. acnes The relationships among the phages within each phages, we compared 62 sequenced phage genomes, group (I–IX) provide insights on the diversity of including our 48 phage genomes and 14 previously P.acnesphagesintheskinmicrobiota.Weobserved published genomes (Farrar et al., 2007; Lood and three types of relationships among the highly Collin, 2011; Marinelli et al., 2012). Similar to their similar phages within the groups (Figure 2 and bacterialhost,P.acnesphageshavelimitedgenomic Supplementary Table S2). First, phages within the diversity.All62phagesarehighlysimilaringenome same group were isolated from the same sample of sequence. The core regions, which are shared by all the same individual. These include PHL067M01, sequencedgenomes,consistof22348bp(76%ofthe PHL067M09andPHL067M10inGroupI;PHL082M00, averagegenomelength)andcontain7232SNPs.The PHL082M02,PHL082M03andPHL082M04inGroupII; average distance among the phages was 0.257 PHL064M01 and PHL064M02 in Group V and (substitution rate at the SNP sites). A phylogenetic PHL116M00 and PHL116M10 in Group IX. Only one tree constructed based on these SNPs (Figure 2), or other pair of phages, PHL117M00 and PHL117M01, only the non-synonymous SNPs (Supplementary which were isolated from the same sample, was not Figure S3), shows that no particular phylogenetic the same strain. Our data suggest that while an clades were found among the phages. individual microbiota can harbor multiple strains of Despite the lack of phylogenetic lineages among phages,itislikelymorecommonthatonestrainofP. the P. acnes phage genomes, we observed several acnes phage dominates the phage population. Sec- groups (I–IX), each of which consists of nearly ond, phages within the same group were isolated identical phages (Figure 2). The phages within each fromdifferentsamplesofthesameindividualsovera group (I–IX) differ by no greater than 14bp within periodof14to21weeks.TheseincludePHL085M01 the entire 29kb genome (Supplementary Table S2). and PHL085N00 in Group VI; PHL114L00 and As a comparison, the average pairwise difference PHL114N00 in Group VII and PHL151M00 and among all 62 phages is 3176bp. To determine PHL151N00 in Group VIII. All paired phages from whether the nearly identical phages within each our longitudinal samples were nearly identical to group represent clones of the same phage strain, we each other. This suggests that the same phage strain estimated the frequency of genetic polymorphism in can persist in an individual skin microbiota. Third, each of our phage isolates. We mapped all available some phages within the same group were isolated sequence reads of each phage to its assembled from different individuals, such as the phages in consensus genome, including the sequence reads GroupsIII,IV,V,VIandVIII.Ofthe43uniquephage PHL009M11 Figure 1 A representative genome of the newly sequenced P. acnes phages. The annotated genome of PHL009M11 is shown as a representativeofthe48newlysequencedP.acnesphagegenomes.Onaverage45openreadingframesareencodedineachphagegenome. TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2083 I II IX VIII * * III * * * IV VII From acne patient From subject with clear skin VI From subject with unknown acne status V * From siblings Figure2 P.acnesphagesarehighlysimilartoeachotherwithnosignificantphylogeneticlineagesobserved.Aphylogenetictreeofthe 62 currently sequenced phage genomes was constructed based on the 7232 SNPs in the core regions. No significant lineages were observed.Ninegroupsofnearlyidenticalphagesareindicated,highlightingthatthephageswithineachgroupbelongtothesamestrain. Brancheswithbootstrapvalueso80(basedon1000resamplings)werecollapsed. strains represented by all 62 isolates sequenced to metagenomic shotgun sequencing data collected date, 5 strains from our study currently show from healthy individuals in the HMP (The Human evidence of inhabiting more than one individual. Microbiome Project Consortium, 2012). Although This suggests that a pool of common P. acnes phage P.acnesphageswerepreviouslyfoundinmetagenomic strainsexistsinthehumanpopulation.Interestingly, sequencing data, their diversity was not analyzed. among the five shared strains, two inhabited related This is the first time that the population diversity of individuals. In Group IV, the two nearly identical P.acnesphagesintheskinmicrobiomeischaracter- phages,PHL150M00andPHL308M00,wereisolated ized. Among the available 27 HMP skin samples, from two brothers. Two of the four phages in Group 9 were collected from the left retroauricular crease VIII,PHL010M04andPHL066M04,andtheirclosely and 18 were collected from the right retroauricular related phage strain PHL073M02 were isolated from crease (Supplementary Table S3). Some samples three siblings (Figure 2 and Supplementary Table were collected from the same individuals. We first S2). This suggests that transmissions of skin bacter- extractedtheP.acnesphagereadsfromeachsample. iophages, either directly or via the transmission of The number of phage reads was from 24–612512 phage-carrying bacterial hosts, are likely to occur (0–2060× coverage on PA6 genome, Supplementary between related individuals. Table S3), independent of the sequencing depth of each sample, suggesting that the relative abundance ofP.acnesphagesintheskinmicrobiotacanvaryin P. acnes phage populations in the skin microbiome a large range among individuals. To validate that our above findings on the phage To determine P. acnes phage populations in diversity in the human skin microbiota were not individual skin microbiota, we next assembled biased due to isolated phages, we analyzed the skin P. acnes phage genomes in each metagenomic TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2084 dataset.Sevensamples(25.9%oftotalsamples)had The assembled phage genomes in the remaining a modest to high sequencing coverage of P. acnes threesamples,HMP03,HMP08andHMP24,contained phages (17×–2060×) (Supplementary Table S3), o20 SNPs, which are in the range of the SNPs found which allowed metagenomic assembly. We per- in a single phage strain. Due to their lower phage formed the SNP analysis on the assembled phage coverages, it is yet inconclusive whether single or genomes using thesame criteriaasin the analysis of multipledominantphagestrainswerepresentinthese complete phage genomes described above. To eval- communities. uate the effect of sequencing depth on the detection Our analysis of the phage diversity from the HMP rate of SNPs, for samples with 430× phage cover- metagenomic data showed that among the skin age, we repeated the phage genome assembly and communities that had detectable P. acnes phages, SNP analysis using only portions of phage reads at three harbored only one dominant strain while one various coverages (20×,100×,250×,500×,1000× harbored two different strains. These findings are and 1500×), as applicable. One of the samples, consistent with our conclusions based on the HMP20, had 41000 SNPs in the core regions of the isolated phages from our study cohort. assembled phage genome, which leveled off to 1353 sites when all the sequence reads (538×) were used intheassembly(Figure3,SupplementaryTableS4). Phage genes under diversification ThissuggeststhattheP.acnesphagepoolinHMP20 Phylogenetically related strains can reflect phage wasadequatelysampledandthatitlikelyconsistsof diversification under selection. Two phages, two dominant phage strains based on phage genome PHL037M02 and PHL073M02, are highly related to comparison (Supplementary Materials). the members of Groups VI and VIII, respectively On the other hand, three other samples, HMP04, (Figure 2). However, they contain many more HMP09 and HMP15, each had six or fewer SNPs in nucleotide variations than 11bp, and thus are thecoregenomeregions,despitehavingsubstantially considered separate strains based on our criterion. higher sequencing coverages than HMP20. This Nonetheless, their high degree of similarity to the suggests that these samples each harbor only one membersofthesegroupsmayreflectrecentselective dominantP.acnesphagestrain.Thisresultsupports pressuresdrivingphagediversification.Weidentified our earlier conclusion that an individual skin 160 sites of nucleotide variations between microbiotaisoftendominatedbyoneP.acnesphage PHL037M02andtheGroupVImembers,50ofwhich strain. We were able to assemble high-quality draft are non-synonymous. All but one of these genetic genomes of P. acnes phages from these three differences is located in a region encoding Gp16, metagenomic data sets, which cover 96.4–96.7% of Gp17andGp18,asannotatedinthegenomeofphage the core genome regions. They are typical of the PA6(SupplementaryFigureS5A).Theexactfunctions P.acnesphagestrains,withhighsimilaritiestothe62 of these genes are unknown, but their location near sequenced genomes. A phylogenetic tree including the 3’ end of the left arm between structural protein these three new genomes with the 62 isolated phage genes and lysis protein genes suggests that they genomes is shown in Supplementary Figure S4. could encode late-acting proteins. Based on the SamplesHMP04andHMP09werecollectedfromthe McDonald–Kreitman test (Egea et al., 2008), gene left and right retroauricular crease of the same gp17 is under selection (P=0.011). individual, and the phage genomes assembled from We identified 81 sites of nucleotide variations these two samples are highly similar, potentially between PHL073M02 and the Group VIII members. originating from the same strain. The sequence differences lie primarily within the region encoding an endolysin and a putative type II holin (Gp20 and Gp21, Supplementary Figure S5B). These lytic cycle proteins permeabilize the cell e core enome mlayemerbratnoeanredledaesgeradenethweexptrhaacgeellulapraprteipcltiedsoglfyrcoamn NPs detected in thssembled phage g 11,,04600200000 HHHHHMMMMMPPPPP0120095043 tPPtthhhHHereeLLye00lb71iska30iecbMMltlyei00nr24oigarsliagnlaiindnvhaidontPsegtHd.tiLwfnr0Aoo6tmsh6MetGhp0srera4oem,suvapeiwmoeuhersoeVlauynIsIicsIeoehmsloatmelrtdaenel.dtmipTobfhnhreaoeurgmdsse,,, Sa of of 10 HMP08 strain. This suggests that the endolysin and holin Number regions 0 0 500 1,000 1,500 2,000 2,500 HMP24 gafiernendeisun,ngw,diehnricahrlalapsrieedqueseesvneocnleutditaiplohnfoa.rgeCpsoh,nawsgieestfmeonuutnltdiwpfliritechqatuiteohnnist, Sequencing coverage amino acid variations in these two gene products. Figure3 P.acnesphagepopulationintheskinmicrobiotaisoften This suggests that mechanisms determining host dominatedbya singlestrain. Thenumbers of SNPs identified in bacteriumlysisspecificityandkineticsmaybeunder thecoreregionsofP.acnesphagegenomesareshownatdifferent selection in these phages. The sequence variation sequencing coverages. The phage genomes were assembled from theHMPmetagenomicshotgunsequencingdata. sites in these two genes among the phages may be TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2085 potentialtargetsforphageengineeringtomanipulate IB-3showthatthesestrainsencodecomponentsofa their lytic activities against bacterial hosts. restriction modification system (genes PPA1611 and The two highly similar phage genomes assembled PPA1612 in KPA171202). This may explain their from the HMP samples, HMP04 and HMP09, which resistance to phages. Among the nine type II strains, werecollectedfromthesameindividual,differedby two strains, HL001PA1 and HL042PA3, were highly 222nucleotides.Mostofthesevariationsarecentered resistant to some of the phages. This is consistent at the 5′ end of the right arm of the genome, which with previous observations that strains of this type encodes putative regulatory or DNA-binding proteins were more frequently resistant to phages (Webster of largely unknown functions. and Cummins, 1978). The resistance to phages observed in type II strains could be partially attributed to the CRISPR mechanism encoded in Range and specificity of Propionibacteria–phage their genomes, which is addressed below. The only interactions type III strain tested, HL201PA1, was resistant to all To determine whether P. acnes phages modulate the 15 phages. Since type III strains are not commonly relativeabundancesofdifferentP.acnesstrainsinthe foundontheskinoftheface,itispossiblethatthese skinmicrobiotabyselective killing, wecharacterized P. acnes phages isolated from the face have not yet the host range and specificity of P. acnes phages.We evolved a mechanism to infect type III strains. tested 15 of the 48 sequenced phages against a panel To determine whether P. acnes phages modulate of74Propionibacteriumstrains,including67P.acnes the abundance and diversity of other species in strains,3P.humerusiistrains,1P.granulosumstrain addition to P. acnes in the skin microbiota, we and 3 P. avidum strains. Except for the P. acnes investigated the host range of P. acnes phages in strains KPA171202, ATCC11828, HL201PA1 and related species. Strains of other human skin- HL202PA1, all of these Propionibacterium strains associated Propionibacteria, including 3 strains of were isolated from the same cohort of subjects P.humerusii,1strainofP.granulosumand3strains sampled for phages. The genomes of all 67P. acnes of P. avidum, were tested against the 15 phages strains and 3 P. humerusii strains have been (Figure 4b). P. humerusii is a newly defined species sequenced (Fitz-Gibbon et al., 2013; Tomida et al., (Butler-Wu et al., 2011). In our previous study, 2013). Our bacterial collection included all major P. humerusii was one of the major species found on lineages of P. acnes found on the human skin, with the skin with a relative abundance of 1.9% in the multiplestrainsrepresentingeachofthemajorclades, pilosebaceous unit based on 16S ribosomal RNA IA-1, IA-2, IB-1, IB-2, IB-3 and II, as well as one type analysis (Fitz-Gibbon et al., 2013). It is closely III strain. We constructed a phylogenetic tree of the related to P. acnes with 498% identity in the 16S 67P. acnes strains based on the SNPs in their core ribosomal RNA gene sequence. P. granulosum and genomic regions (Figure 4a) (Tomida et al., 2013). P.avidumarecommonskincommensals(Cummins, Usingamodifiedcross-streakmethod,wedetermined 1976; Ördögh and Hunyadkürti, 2013). While all theresistance/susceptibilityofeachofthe74bacterial tested P. granulosum and P. avidum strains showed strains against the 15 phages. In total, 1110 bacter- strong resistance to all the phages, two P. humerusii ium–phage interactions were measured. Each experi- strains, HL037PA2andHL037PA3,were susceptible ment was repeated a minimum of five times. For the to all the phages tested. The third P. humerusii bacterialstrainsthatshowedresistancetophages,we strain, HL044PA1, was susceptible to 10 of the 15 determinedthefoldincreaseinresistancebymeasuring phagestested.Ourresultsshowthatthehostrangeof efficiency of plaquing (EOP) relative to the P. acnes P. acnes phages is not limited to P. acnes but also strain ATCC6919, which is known to be susceptible includes a closely related Propionibacterium species, to all tested phages. suggesting that P. acnes phages may also be able to We found that the outcome of the bacterium– modulate P. humerusii populations in the skin phageinteractionsisP.acneslineagedependent.All microbiota. type I P. acnes strains (clades IA-1, IA-2, IB-1 and IB-2) except clade IB-3 were susceptible to all tested phages (Figure 4a). Among them, the phages often P. acnes phages can adopt a pseudolysogenic state formed turbid plaques on P. acnes strains of clade depending on the host P. acnes strains IA-1, but clear plaques on strains of clades IB-1 and IthasbeensuggestedthatP.acnesphagesmayenter IB-2, as summarized in Figure 5. This suggests that pseudolysogeny as an alternative to the lytic cycle thesephagesengageintwodifferentstatesdepending (Farrar et al., 2007; Lood and Collin, 2011). As on the host strains: a pseudolysogenic response in describedabove,wediscoveredthatP.acnesphages cladeIA-1strains,andalyticcycleincladeIB-1and often adopt a pseudolysogenic state in clade IA-1 IB-2 strains. strains, but rarely in clade IB-1 and IB-2 strains, CertainP.acnesstrainsofcladesIB-3,IIandIIIare suggesting that their pseudolysogeny is dependent highly resistant to multiple phages. Two strains of on the host P. acnes strains (Figure 5). In support of clade IB-3 (KPA171202 and HL030PA1) were highly the existence of pseudolysogeny in P. acnes phages resistant to most of the tested phages with a ⩾100- and consistent with the result by Marinelli et al., fold increase in resistance. The genomes of clade (2012), our genome sequencing data revealed TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2086 Phage Strains Group VI Group VIII Proapcionnesib aSctrtaeirnium Clade Ribotype CRISPR/Cas PHL071N05 PHL113M01 PHL111M01 PHL082M00 PHL060L00 PHL067M10 PHL112N00 PHL037Z02 PHL115M02 PHL085N00 PHL085M01 PHL114L00 PHL073M02 PHL010M04 PHL066M04 HL036PA1 532 - S S S S S S S S S S S S S S S HL036PA2 532 - S S S S S S S S S S S S S S S HL036PA3 1 - S S S S S S S S S S S S S S S HL005PA3 1 - S S S S S S S S S S S S S S S HL005PA2 1 - S S S S S S S S S S S S S S S HL020PA1 1 - S S S S S S S S S S S S S S S HL027PA2 1 - S S S S S S S S S S S S S S S HHLL100103PPAA12 IA-1 11 -- SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS HL087PA2 1 - S S S S S S S S S S S S S S S HL063PA1 1 - S S S S S S S S S S S S S S S HL072PA2 5 - S S S S S S S S S S S S S S S HL072PA1 5 - S S S S S S S S S S S S S S S HL046PA2 1 - S S S S S S S S S S S S S S S HL002PA2 1 - S S S S S S S S S S S S S S S HL002PA3 1 - S S S S S S S S S S S S S S S HL078PA1 1 - S S S S S S S S S S S S S S S HL106PA2 1 - S S S S S S S S S S S S S S S HL099PA1 4 - S S S S S S S S S S S S S S S HL083PA1 1 - S S S S S S S S S S S S S S S HL038PA1 4 - S S S S S S S S S S S S S S S HL074PA1 4 - S S S S S S S S S S S S S S S HHLL000455PPAA11 IA-2 44 -- SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS HL007PA1 4 - S S S S S S S S S S S S S S S HL096PA1 5 - S S S S S S S S S S S S S S S HL043PA1 5 - S S S S S S S S S S S S S S S HL043PA2 5 - S S S S S S S S S S S S S S S HL053PA1 4 - S S S S S S S S S S S S S S S HL056PA1 4 - S S S S S S S S S S S S S S S HL025PA1 1 - S S S S S S S S S S S S S S S HL086PA1 8 - S S S S S S S S S S S S S S S HL082PA1 8 - S S S S S S S S S S S S S S S HHLL101503PPAA22 IB-1 88 -- SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS HL092PA1 8 - S S S S S S S S S S S S S S S HL110PA1 8 - S S S S S S S S S S S S S S S HL030PA2 3 - S S S S S S S S S S S S S S S HL063PA2 3 - S S S S S S S S S S S S S S S HL037PA1 3 - S S S S S S S S S S S S S S S HL059PA1 16 - S S S S S S S S S S S S S S S HL059PA2 16 - S S S S S S S S S S S S S S S HL025PA2 3 - S S S S S S S S S S S S S S S HL005PA4 3 - S S S S S S S S S S S S S S S HL067PA1 3 - S S S S S S S S S S S S S S S HL002PA1 IB-2 3 - S S S S S S S S S S S S S S S HL027PA1 3 - S S S S S S S S S S S S S S S HL046PA1 3 - S S S S S S S S S S S S S S S HL083PA2 3 - S S S S S S S S S S S S S S S HL013PA1 3 - S S S S S S S S S S S S S S S HL050PA1 3 - S S S S S S S S S S S S S S S HL050PA3 3 - S S S S S S S S S S S S S S S HL087PA1 3 - S S S S S S S S S S S S S S S HL087PA3 3 - S S S S S S S S S S S S S S S KHPLA013701P2A012 IB-3 11 -- SS > S10 > S10 SS > S10 >> 1100 >> 1100 >> 1100 >> 1100 >> 1100 >> 1100 >> 1100 >> 1100 >> 1100 >> 1100 HL050PA2 1 - S S S S S > 10 S S S S S S S S S HL060PA1 2 + S S S S S S S S S S S S S S S HL103PA1 2 + S S S S S S S S S S S S S S S HL082PA2 2 + S S S S S S S S S S S S S S S AHTLC0C011P18A218 II 22 ++ SS SS > S10 SS SS > S10 SS SS SS SS SS > S10 SS SS SS HL110PA3 6 + S S S S S S S S S S S S S S S HL110PA4 6 + S S S S S S S S S S S S S S S HL042PA3 6 + > 10 S > 10 > 10 S > 10 S > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 HL202PA1 6 + S S S S S S S S S S S S S S S HL201PA1 III N/A - > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 S susceptible 10 fold increase in resistance RT1 RT2 RT3 RT4 RT5 RT6 RT8 RT16 RT532 Phage Strains Group VI Group VIII NStarmaine PropiSonpiebcaiectserium PHL071N05 PHL113M01 PHL111M01 PHL082M00 PHL060L00 PHL067M10 PHL112N00 PHL037M02 PHL115M02 PHL085N00 PHL085M01 PHL114L00 PHL073M02 PHL010M04 PHL066M04 HL037PA2 S S S S S S S S S S S S S S S HL037PA3 P. humerusii S S S S S S S S S S S S S S S HL044PA1 S S S S > 10 S > 10 >10 > 10 S S S S S > 10 HL078PG1 P. granulosum > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 HL063PV1 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 > 10 HL083PV1 P. avidum R R R R R R R R R R R R R R R HL307PV1 R R R R R R R R R R R R R R R S susceptible R resistant 10 fold increase in resistance Figure4 HostrangeandspecificityofP.acnesphages.Resistance/susceptibilityofPropionibacteriumstrains(inrows)against15ofthe 48sequencedphages(incolumns)isshown.(a)Phageinfectionoutcomesof67P.acnesstrains.AllP.acnesstrainsincladesIA-1,IA-2, IB-1andIB-2weresusceptibletothetestedphages,whilephageresistancewasfoundinstrainsofcladesIB-3,IIandIII,coloredinpink. ThedendrogramtotheleftshowsthephylogeneticcladesofP.acnesstrains(Fitz-Gibbonetal.,2013).Onlytopologyisshown.(b)Phage infectionoutcomesofthreeP.humerusiistrains,oneP.granulosumstrainandthreeP.avidumstrainsshowthatP.acnesphagescould infectandlyseP.humerusiistrains,whileP.granulosumandP.avidumwereresistanttoalltestedphages. TheISMEJournal P.acnesphagepopulationintheskinmicrobiota JLiuetal 2087 PHL111M01 3.5 PHL071N05 3 PHL060L00 core 2.5 PPHHLL011627NM0100 y s 2 PHL115M02 dit 1.5 PHL113M01 bi PHL085M01 Tur 1 PHL037M02 0.5 PHL114N00 PHL010M04 0 PHL066M04 IA-1 IA-2 IB-1 IB-2 II PHL073M02 (n=16) (n=14) (n=6) (n=17) (n=7) P. acnes clade Figure5 ThefrequencyofphagepseudolysogenyvariesamongdifferentP.acnesstrains.Theturbidityofthephageplaquesformedon P.acnescultureplateswasexamined.Datafrom60P.acnesstrainschallengedby13phageswererecordedandsummarized.The60 P.acnesstrainsbelongtofiveclades:IA-1(n=16),IA-2(n=14),IB-1(n=6),IB-2(n=17)andII(n=7).Theaverageturbidityscoreofthe bacterialstrainsineachcladechallengedbyeachphage(incolors)isshown.Independentofthephagestested,theplaqueturbidityscore variedamongdifferentP.acnesstrains:itishighincladeIA-1andlowincladesIB-1andIB-2.Thissuggeststhatthephagestendtoentera pseudolysogenicstateincladeIA-1strainsandalyticcycleincladesIB-1andIB-2strains. the ends of the phage genomes to be flanked by 11- (Farrar et al., 2007; Lood and Collin, 2011), but nucleotide single-stranded overhangs. Previous exists as an extrachromosomal element. reports suggested that these overhangs may be Insummary,allaboveresultssuggestthatP.acnes involvedinthecircularizationofthephagegenomes phages can adopt a pseudolysogenic state in clade (Farrar et al., 2007; Lood and Collin, 2011). To test IA-1 strains. thishypothesis,wedesignedPCRprimersannealing to the ends of the phage genomes. A PCR product spanning the two ends with the predicted size Resistancetobacteriophagesdoesnotcorrelatewiththe (~735bp) and sequence was amplified from all the presenceofmatchingCRISPRspacersintypeIIP. acnes phages tested, suggesting that the phage DNA can strains existinacircularformmediatedbytheoverhangsat Since certain type II P. acnes strains are resistant to the ends (Supplementary Figure S6A). phages, we next investigated whether the CRISPR/ To demonstrate the pseudolysogenic properties of Cas mechanism could explain the resistance of the P. acnes phages, we infected P. acnes strain typeIIstrainsagainstphages.Amongthe67P.acnes ATCC6919, a clade IA-1 strain (Liu et al., 2014), strains, 9 belong to type II and encode CRISPR/Cas withfivedifferentphages(PHL060L00,PHL112N00, elements. Each of the type II strains has one to nine PHL037M02,PHL073M02andPHL114L00).Follow- 33-bp spacers in their CRISPR arrays (Tomida et al., ing the formation of plaques by each phage, re- 2013). In total, they encode 36 spacers, 20 of which growth of the bacteria was observed starting in the are unique. We identified 34 unique protospacers in center of the plaque regions. The re-grown bacteria the15testedphagegenomesthatmatchanyofthe20 showed no evident lysis when challenged by 13 unique spacer sequences in the 9 type II P. acnes phages that previously could lyse this P. acnes strains. Because the CRISPR/Cas system has been strain, including the phages of the initial exposure shown to tolerate a limited number of mutations in (Supplementary Figure S6B). This suggests that the protospacer targets (Semenova et al., 2011; Manica bacterial host gained superinfection immunity after et al., 2013), in our analysis we allowed up to two infection by these phages. mismatches for a sequence to be considered a To further determine whether the phage DNA recognizable protospacer. Similar results were exists as an episome in the bacterial host after obtainedwhenonlyperfectlymatchingprotospacers infection, we tested the presence of phage DNA in were considered. We found that all identified four distinct colonies of the re-grown ATCC6919 protospacers are located primarily on the left arm culture that was initially infected with PHL060L00 ofthephagegenomes,whichismoreconservedthan andsubsequentlypassaged.Twoofthefourcolonies therightarm(SupplementaryFigureS7).Inaddition, produced an expected 437bp amplicon in a PCR the locations of the protospacers are generally targetingthegp11gene(SupplementaryFigureS6C), conserved among all phage genomes that harbor supportingthepresenceofphageinasubpopulationof the same protospacer sequences. These suggest that there-grownP.acnesasanepisome.Inaddition,we the CRISPR/Cas system tends to target the more sequenced the genomic DNA extracted from two conserved regions of the phage genomes. ATCC6919 cultures, each of which was passaged In contrast to a prior report (Marinelli et al., 2012), fromare-growncultureafterphageinfection.Inboth wefoundthattheresistance/susceptibilityofthenine cases, the phage reads obtained from whole genome type II P. acnes strains against phages did not sequencing were assembled into complete genomes correlate with the presence/absence of at least one that are separate from host P. acnes contigs, phage-matching CRISPR spacer (r=0.39, Figure 6). supporting earlier evidence that P. acnes phage There were multiple observations that even though DNA does not integrate into the host genome the strain encodes a matching CRISPR spacer, it was TheISMEJournal
Description: