Strategies for Miniaturized Biomarker Detection Adler, Belinda 2014 Link to publication Citation for published version (APA): Adler, B. (2014). Strategies for Miniaturized Biomarker Detection. [Doctoral Thesis (compilation), Department of Biomedical Engineering]. Department of Biomedical Engineering, Lund university. Total number of authors: 1 General rights Unless other specific re-use rights are stated the following general rights apply: Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the public portal Read more about Creative commons licenses: https://creativecommons.org/licenses/ Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. LUND UNIVERSITY PO Box 117 221 00 Lund +46 46-222 00 00 Strategies for Miniaturized S t r a t e Biomarker Detection g M WVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAA ies for Min HCIRN iat WGSIGESPAEYECFTLTTGPKLAKLPEQQCTVPDLLDHMVIVPLEASRCPKPNSEVLDSYAGVTDWCKTVASLVQTEHIAVGYPHQREPKSLQWLVKRIGKVLDTNPTLINVAKMCFMVLLLDPCGAHGGSSRDWSGTSGCGTDSKDGPRLFRNKLLSMDYLPHKPFSSVIHLSLVGRQFHVSLQFGHTPDE urized Biomarker Detection B e lin d a A d Belinda Adler le r ISBN: 978-91-7473-945-9 (printed) ISBN: 978-91-7473-946-6 (electronic) Department of Biomedical Engineering ISRN: LUTEDX/TEEM – 1095 – SE Faculty of Engineering Report: 2/14 Lund University Strategies for Miniaturized Biomarker Detection A tale of invisible things Belinda Adler Advisors Prof. Thomas Laurell, Biomedical Engineering, LTH, Lund University, Lund Assistant Advisors Dr. Simon Ekström, Biomedical Engineering, LTH, Lund University, Lund Prof. Sophia Hober, Biotechnology, KTH, Stockholm Faculty Opponent Prof. Richard Oleschuk, Chemistry, Queens University, Kingston, Canada Board of Examination Prof. Åsa Emmer, Applied Physical Chemistry, KTH, Stockholm Associate Prof. Martin Johansson, Laboratory Medicine, Pathology, Lund Univ, Malmö Associate Prof. Ann Brinkmalm, Neuroscience and Physiology, Sahlgrenska Academy, University of Gothenburg, Gothenburg Deputy Associate Prof. Patrik Önnerfjord, Molecular Skeletal Biology, Lund University, Lund Public Defense Doctoral thesis by due permission of the Faculty of Engineering, Lund University, Sweden, will be publicly defended on Wednesday 28 May, 2014, at 9.30 a.m. in E:1406, Ole Römers väg 3, Lund. Copyright © Belinda Adler 2014 Department of Biomedical Engineering Faculty of Engineering, Lund University P.O. Box 118, SE-221 00 Lund, Sweden www.bme.lth.se ISBN: 978-91-7473-945-9 (printed version) ISBN: 978-91-7473-946-6 (electronic version) ISRN: LUTEDX/TEEM – 1095 – SE Report: 2/14 Printed in Sweden by Tryckeriet E-huset, Lund University Till Anders, Mamma, Pappa och Pontus Contents List of Publications .................................................................................................. 1 Abbreviations ........................................................................................................... 2 Introduction ............................................................................................................ 3 Background ............................................................................................................. 4 Biomarkers .............................................................................................................. 5 Sensitivity and Specificity .............................................................................. 7 Prostate Specific Antigen ............................................................................... 8 Proteomics ............................................................................................................. 10 Sample Preparation ..................................................................................... 11 Solid Phase Extraction ........................................................................ 12 Protein Digestion ........................................................................................ 13 Affinity Purification ..................................................................................... 14 Immunoaffinity .................................................................................. 15 Aptamer Affinity ................................................................................. 15 Metal Ion Affinity ............................................................................... 16 Miniaturization ...................................................................................................... 17 Scaling Effects in Microfluidics .................................................................... 19 Micro Fabrication ........................................................................................ 21 Porous Silicon ..................................................................................... 21 Antibody Microarrays ............................................................................................ 23 Mass Spectrometry ................................................................................................. 25 MALDI ....................................................................................................... 25 PMF and MS/MS........................................................................................ 27 Sample Preparation Platforms ...................................................................... 27 Mass Tags .................................................................................................... 28 ISET Platform ....................................................................................................... 29 Applications ................................................................................................ 32 Summary of the Manuscripts ................................................................................. 33 Paper I ........................................................................................................ 33 Paper II ....................................................................................................... 34 Paper III ...................................................................................................... 35 Paper IV ...................................................................................................... 36 Paper V ....................................................................................................... 37 Paper VI ...................................................................................................... 38 Outlook ................................................................................................................ 39 Populärvetenskaplig sammanfattning ..................................................................... 40 Acknowledgement ................................................................................................. 42 References ............................................................................................................. 44 Appendix: Paper I-IV ............................................................................................ 58 List of Publications This thesis is based on the following papers, which will be referred to in the text by their Roman numerals (I-VI). The papers are appended at the end of the thesis. I. Porous Silicon Antibody Microarrays for Quantitative Analysis: Measurement of Free and Total PSA in Clinical Plasma Samples Järås, K.*, Adler, B.*, Tojo, A., Malm, J., Marko-Varga, G., Lilja, H. and Laurell, T. Clinica Chimica Acta, 414, 76-84 (2012) II. Optimizing Nanovial Outlet Designs for Improved Solid-Phase Extraction in the Integrated Selective Enrichment Target–ISET Adler, B., Laurell, T. and Ekström, S. Electrophoresis, 33, 3143-3150 (2012). Cover illustration. III. MALDI-Target Integrated Platform for Affinity-Captured Protein Digestion Ahmad-Tajudin, A., Adler, B., Ekström, S., Marko-Varga, G., Malm, J., Lilja, H. and Laurell, T. Analytica Chimica Acta, 807, 1-8 (2014). Cover illustration. IV. Miniaturized and Automated High-Throughput Verification of Proteins in the ISET Platform with MALDI MS Adler, B.*, Boström, T.*, Ekström, S., Hober, S. and Laurell, T. Analytical Chemistry, 84, 8663-8669 (2012) V. Mass Tag Enhanced Immuno-MALDI Mass Spectrometry for Diagnostic Biomarker Assays Lorey, M., Adler, B., Yan, H., Soliymani, R., Ekström, S., Yli- Kauhaluoma, J., Laurell, T. and Baumann, M. Submitted VI. Aptamer/ISET-MS: A New Affinity Based MALDI Technique for Improved Detection of Biomarkers Lee, S., Adler, B., Ekström, S., Rezeli, M., Vegvari, A., Park, J., Malm, J., and Laurell, T. Submitted * Authors contributed equally. Printed with permission. 1 Abbreviations BCA bicinchoninic acid assay LOC lab-on-a-chip BPH benign prostatic hyperplasia MALDI matrix assisted laser desorption/ionization CHCA α-cyano-4-hydroxycinnamic acid MS mass spectrometry CRP c-reactive protein PCR polymerase chain reaction DHB 2,5-dihydroxybenzoic acid PDMS polydimethylsiloxane DNA deoxyribonucleic acid PEEK polyetheretherketone DRIE deep reactive-ion etching pI isoelectric point DTT dithiothreitol PMF peptide mass fingerprint EGF epidermal growth factor PrEST protein epitope signature tags ELISA enzyme-linked immunosorbent assay PSA prostate specific antigen ESI electrospray ionization PTM posttranslational modification FDA U.S. food and drug administration RNA ribonucleic acid His histidine RP reverse phase hk2 human kallikrein 2 SAX strong anion exchange HPA Human proteome atlas SCX strong cation exchange HUPO Human proteome SELEX systematic evolution of organization ligands by exponential enrichment IMAC immobilized metal ion affinity chromatography SPE solid phase extraction IMER immobilized enzyme reactor TOF time of flight ISET integrated selective μTAS micro total analysis systems enrichment target 2
Description: