Hemodialysis International2006; 10:326–337 Trainee Forum Review of dialysate calcium concentration in hemodialysis Nigel TOUSSAINT, Patrick COONEY, Peter G. KERR DepartmentofNephrology,MonashMedicalCentre,Clayton,Vic.,Australia Abstract Thedialysatecalcium(Ca)concentrationforhemodialysis(HD)patientscanbeadjustedtomanage moreoptimallythebody’sCaandphosphatebalance,andthusimprovebonemetabolismaswellas reduceacceleratedarteriosclerosisandcardiovascular mortality.TheappropriatedialysateCacon- centration allowing this balance should be prescribed to each individual patient depending on a multitude of variable factors relating to Ca load. A lower dialysate Ca concentration of 1.25 to 1.3mmol/LwillpermittheuseofvitaminDsupplementsandCa-basedphosphatebindersinclinical practice, with much less risk of Ca loading and resultant hypercalcemia and calcification. Low Ca bathsareusefulinthesettingofadynamicbonediseasewhereanincreasein boneturnoverisre- quired. However, low Ca levels in the dialysate may also predispose to cardiac arrhythmias and hemodynamically unstable dialysis sessions with intradialytic hypotension. Higher Ca dialysate is useful to sustain normal serum Ca levels where patients are not taking Ca-based binders or if Ca supplements are not able to normalize serum levels. Suppression of hyperparathyroidism is also effective with dialysate Ca of 1.75mmol/L, but hypercalcemia, metastatic calcification, and over- suppression of parathyroid hormone are risks. Dialysate Ca of 1.5mmol/L may be a compromise betweenboneprotectionandreductionincardiovascularriskforconventionalHDandisacommon concentration used throughout the world. The increase in longer, more frequent dialysis such as short-dailyandnocturnalHD,however,providesanotherchallengewithregardtooptimaldialysate Calevelsandhigherlevelsof1.75mmol/Lareprobablyindicatedinthissetting.Difficultiesinde- terminingtheidealdialysateCaoccurbecauseofthecomplexpathophysiologyofboneandmineral metabolisminHDpatientsandthereneedstobeabalancebetweendialysisprescriptionandother treatment modalities. To optimize management of the abnormal Ca balance, other aspects of this disorder need to be more fully clarified and, with evolving medications for phosphate control and treatment of secondary hyperparathyroidism, as well as the emergence of a multitude of different HDregimes,furtherstudiesarerequiredtomakedefinitiverecommendations.Atpresent,weneed tomaintainflexibilitywithHDtreatmentsandsodialysateCaneedstobeindividualizedtomeetthe specificrequirementsofpatientsbyoptimizingmanagementofrenalbonediseaseandsimultane- ouslyreducingmetastaticcalcificationandcardiovasculardisease. Key words: Dialysate calcium, hemodialysis, calcium balance, vascular calcification, mineral me- tabolism,calcium(cid:1)phosphateproduct Correspondence to: P. G.Kerr, Department ofNephrology, Monash Medical Centre, 246 ClaytonRd, Clayton, Vic. 3168, Australia. E-mail: [email protected] 326 r 2006 The Authors. Journal compilation r 2006 International Society for Hemodialysis Dialysatecalciumconcentration CLINICAL TRAINING AT MONASH drop-inclinics.Allclinicsarefollowedbyadiscussionof MEDICAL CENTRE, CLAYTON, the patients seen, with all attendees at the clinic (con- MELBOURNE, VIC., AUSTRALIA sultants, registrars, and residents)—this usually takes up to an hour. There is a weekly department meeting with The training pathway for medical specialties in Australia presentations of renal histology, scientific work, or other is governed by the Royal Australasian College of Physi- nephrology topics and there is a second weekly journal cians (covering Australia and New Zealand). After a club.Thehospitalhasaweeklygeneralmedicinemeeting compulsory intern year, trainees typically enter ‘‘basic as well (similar to a grand round). In addition, all ad- training’’ that incorporates exposure to all medical spe- vancedtraineesmustcompletea‘‘project’’ineachyearof cialtiesandgeneralmedicine.Thisoccurspredominantly training—this is usually a small clinical research topic, in teaching hospitals with some secondment to smaller many of which have been published. suburbanandruralhospitals.Basictrainingtakes3years, The department also has 5 nephrology PhD students wherein trainees progress through working as a resident who have completed their advanced training but who doctor(similartoaHouseOfficer)toregistrarlevelwhere have elected to pursue research. Three are involved in theysuperviseresidents.Inthethirdyearofthistraining, laboratory research (glomerulonephritis, diabetes, and thereare2examinations.Firstly,thereisthewrittenexam peritoneal membrane pathobiology) and 2 in clinical re- (multiplechoice format), which incorporates clinical sci- search (dialysis nutrition and vascular disease). The De- ences and clinical medicine in all internal medical disci- partmentiscurrentlyinvolvedin23clinicaltrialsandhas plines. If successful at this examination, candidates may anactivebasicsciencelaboratory,including14scientists. thensitaclinicalexamination,whichhasaformatoflong andshortcasesextendingoverawholeday(2longcases Training in dialysis and 4 short cases)—again, cases are drawn from all as- pects of internal medicine. As mentioned, Monash Medical Centre cares for about Once successful at the examinations, candidates com- 485 dialysis patients, including 135 patients on perito- plete the 3 years of basic training and enter ‘‘advanced neal dialysis (PD), and there are about 70 to 90 new di- training.’’ This is usually discipline specific—in the case alysis patients entering the program each year. Dialysis inpoint,innephrology.Advancedtrainingspansafurther educationforadvancedtraineesoccursatavarietyoflev- 3 years and incorporates at least 2 clinical years as a Ne- els,includingtreatingin-hospital patientsandambulato- phrology Registrar but may include a third elective year, rycarepatients.PeritonealdialysisisofferedasCAPDand either in another specialty or in research. Many candi- APD; hemodialysis (HD) is offered as satellite and home dates overlap a PhD year at this point. There are no exit (in-center tends to be a transit zone only). Home HD examinations but there are annual reports on progress, includes conventional and nocturnal dialysis, and the submitted toaSpecialistAdvisoryCommittee thatisdis- department currently has 31 patients on nocturnal HD. cipline specific. The registrar covering dialysis at any one time is re- AtMonashMedicalCentre,werunalargeprogramby sponsible for ambulatory management of outpatient HD Australian standards. The Nephrology Department cares and PD patients. As with all nephrology units in Mel- for485dialysispatientsandover500transplantpatients, bourne, training in ambulatory dialysis for the advanced including kidney–pancreas transplantation. There are 3 trainee at Monash Medical Centre occurs throughout the clinicalregistrarswhorotatethroughcareoftheinpatient duration of the 3 years of clinical practice as a registrar, ward, dialysis, and transplantation (transplant patients andisintegraltotheoverallefficiencyofHDpatientcare are cared for by the Physicians in Australia). There are inthedepartment.Thereisoneco-ordinateddialysisout- usuallyabout25to30inpatientsatanyonetimebutre- patient clinic per week with regular attendance by Con- nalbiopsiesandmanysurgicalproceduresareperformed sultants and registrars, as well as allied health staff in- as day cases. We perform around 300 renal biopsies per cludingadietician,socialworker,anddialysiseducators. year(nativeandtransplant),andthereareabout40to45 Thereare20to25HDinpatientsatanyonetimecared transplants per year (including 8–10 kidney-pancreas). for by the ward registrar, but with good clinical practice Educationalactivitiesincludeformalroundingwiththe most management of patients will occur in the commu- consultant 3 times/week, separately in general nephro- nity with regular out-patient review. In-patient HD logy and transplantation, and attendance at a dialysis training involves regular ward rounds with the consult- clinic weekly and a glomerulonephritis clinic weekly. ant,anddirectcommunicationwithdialysisnursingstaff There are 2 formal transplant clinics weekly, plus daily and between registrars. There would typically be about Hemodialysis International2006; 10:326–337 327 Toussaintetal. 10 to 15 acute HD patient admissions per month, and centrationwasusedasthismostcloselymatchednormal review of patients in the intensive care setting, especially serum ionized Ca. It was soon discovered that higher of those requiring support with hemofiltration, is also levelsofCawererequiredtosustainserumCalevelsand crucialtooptimaltrainingofadvancedtraineesatMonash to increase Ca load, therefore preventing hypocalcemia Medical Centre. and renal bone disease.3 The administration of active vitamin D (calcitriol) in the 1970s eliminated the need for the dialysate to im- DIALYSATE CALCIUM prove Ca load and a higher dialysate Ca concentration, with a net flux of Ca into the patient, was not required. Clinical scenerio With the introduction of Ca-based phosphate binders in A54-year-oldmalehasbeenmanagedwithHDfor3years. the late 1980s, in association with calcitriol use, hyper- Hisdialysisparametersinclude—4hr,3times/week,using calcemiabecameamorecommonpotentialproblem,and a1.6m2polysulfonehigh-fluxdialyzer,achievingaspKt/V alowerCadialysatewasre-introduced.Slatapolskyetal., of 1.5. He has always struggled with phosphate control. in1986,reportedonHDpatientsreceivingCacarbonate Owing to regulatory restrictions, sevelemar hydrochloride asphosphatebindersinassociationwithdialysiscontain- is unavailable. His phosphate control includes calcium ing 1.75mmol/L Ca dialysate revealing the complication carbonate, 2 tablets 3 times daily with meals, and alumi- of hypercalcemia.4 A repeat analysis of patients reported numhydroxide,1tablet3timesdailywithmeals.Healso in 1989, with lower Ca dialysate (1.25mmol/L) and as- takes calcitriol 0.25mcg daily. His serum calcium is sociated Ca carbonate administration, at an average dose 2.6mmol/L, phosphate 2.1mmol/L, intact parathyroid of10.5g/day,demonstratednohypercalcemia.5Theben- hormone (iPTH) level is 53pmol/L, and albumin is 38g/ efitsoflowCadialysateinassociationwithCa-containing L.OneisconcernedabouthisiPTHlevelandwouldliketo bindersandalsowithcalcitriolhavealsobeenconfirmed increase his calcium carbonate to 9 tablets daily but are in many early studies, with the active vitamin D compo- concerned about his serum calcium. nent effective in treating patients with secondary hyper- Whatoptionsinthedialysatecalciumconcentrationareavail- parathyroidism (HPT).6,7 able? What is the ‘‘correct’’ dialysate calcium? However, the more recent introduction of non-Ca, nonaluminum-basedphosphatebinders,noncalcemicvi- tamin D analogues, as well as the emergence of calcimi- REVIEW meticagentsintoclinicalpracticeimprovingmanagement of mineral metabolism, have made the current choice of Introduction dialysate Ca even more difficult, and also more crucial. Usingtheappropriatedialysatecalcium(Ca)concentration Current management of mineral in HD patients has important management implications with regard to the prevention of renal bone disease and metabolism also, more importantly, the reduction of vascular calcifi- Patients with end-stage kidney disease (ESKD) have a cation. Manipulations of the dialysate Ca concentration disruptioninsystemicCaandphosphatehomeostasis.As enable alterations in Ca load as dialysate Ca impacts on a result of limited excretion of phosphate, diminished serum Ca, phosphate, and parathyroid hormone (PTH) hydroxylationof25-hydroxyvitaminDtocalcitriol(1,25- and,mostlikely,softtissuecalcification.Concentrationsin dihydroxyvitaminD)andresultinghypocalcemia,thereis thedialysatecanbecustomizeddependingonthecurrent an effect on bone, the gut, and the parathyroid glands. andtargetedserumCalevelsaswellasthedesiretomain- HypersecretionofPTHisinitiallyappropriatebyincreas- tain hemodynamic stability during dialysis.1 ing Ca phosphate release from bone and enhancing uri- nary phosphate excretion (via a decrease in proximal Historical perspective reabsorption). PTH can, in early stages, correct both the Dialysate in general, with its electrolyte and acid-base hypocalcemia and the hyperphosphatemia. With declin- components, has evolved specifically and scientifically ing kidney function, worsening phosphate retention is throughstudiestoprovidethebestoutcomemeasuresfor intimately related to the common development of sec- patients on HD, but the optimal dialysate Ca concentra- ondary HPT. The latter is a major cause for concern be- tion is yet to be delineated.2 When dialysis was initially causethehighcirculatinglevelsofPTHplayanimportant introduced in the 1960s, 1.25mmol/L dialysate Ca con- roleinthedevelopmentofrenalosteodystrophyandpos- 328 Hemodialysis International2006; 10:326–337 Dialysatecalciumconcentration sibly in other uremic complications as well. Increased Worldwide practice levels of PTH are also closely associated with cardiovas- cular disease in dialysis patients. WorldwideuseofdialysateCavariesthroughoutdifferent CurrentmanagementofmineralmetabolisminESKDin- countries.Themostrecentclinicalpracticeguidelinesby volvesthecontrolofhyperphosphatemiaandtheuseofac- the National Kidney Foundation (New York, United tivevitaminDcompoundstosuppressPTH,withanaimto States) Kidney Disease Outcome Quality Initiative (K/ obtainnormalizationofserumCaandphosphate.Phosphate DOQI) guidelines recommend a dialysate Ca concentra- controlindialysispatientsisdifficultandmanagementrelies tion of 1.25mmol/L rather than 1.5mmol/L to avoid ondietaryrestriction,theuseofphosphatebinders,manyof excessCaloadandpreventvascularcalcification,2where- whichareCa-based,anddialysis.8Dialysishaslimitedabil- as in Japan and Australia a dialysate of 1.5mmol/L is ity for phosphate control although phosphate removal by common.ThereisnorecommendationfordialysateCain HD is very much a time-dependent process.9 the European Best Practice Guidelines (EBPG). The first Aluminum hydroxide was initially thought to be the Dialysis Outcomes and Practice Patterns Study (DOPPS) ideal phosphate binder, especially being the most cost involved 307 HD centers with participants from Japan, effective;however,ithaslargelybeenabandonedbecause United States, and Europe, and revealed that the average of the risks of aluminum toxicity with osteomalacia and dialysate Ca concentration was 1.45mmol/L, 60% of encephalopathy.10 If aluminum-based binders are need- patients exceeding the K/DOQI recommendation.19 ed, certain guidelines recommend against their use for Lower dialysate Ca in general was more predominantly longer than 4 weeks.2 Ca carbonate and Ca acetate sub- used in the United States. Interestingly, from the DOPPS sequently replaced aluminum hydroxide as the most data there was a significantly increased all-cause (but commonly used phosphate binders but their use is asso- notcardiovascular)mortalityriskassociatedwithahigher ciated with hypercalcemia, especially in association with Ca dialysate. the use of vitamin D metabolites or higher dialysate Ca Despiteallstudiessofar,recommendationsworldwide concentrations.11 Although patients were previously di- arebasedmostlyonopinion,withmortalityandmorbid- alyzedagainst1.5or1.75mmol/LCabathstopreventCa ity data currently lacking, to answer the question of depletion, as mentioned with the widespread use of Ca- which dialysate Ca is the safest and most effective. Rec- salts,asphosphatebinders,reducedCadialysatebecame ommendationsfromLocatellietal.,basedonaconsensus standard.MorephysiologicaldialysatewithalowerCaof fromthethird‘‘AccordWorkshop,’’heldinParisin2000 1.25mmol/L allowed for increased intestinal Ca absorp- and published in 2002, suggested that the dialysate Ca tionwithCa-basedmedication,withoutapositivedialysis content should be 1.5 to 1.75mmol/L, with 1.5mmol/L Ca balance and resultant hypercalcemia.12,13 preferredinpatientstakingCasupplementsorvitaminD With thischange, however, thereisanassociationwith analoguestoavoidapositiveCabalance.20Theconsensus worsening secondary HPT, as a result of negative dialysis recommendedadialysateCaconcentrationof1.75mmol/ Ca balances, and the use of Ca-containing binders is L if patients were not on these medications, and it sug- perhaps only more likely to accelerate the process of Ca gestedthat1.25mmol/Lshouldbeavoidedforprolonged deposition and vascularcalcification.12,14–17 Also, a lower periods due to risks of aggravating secondary HPT. dialysateCahasnotbeenshowntoproducepositiveeffects Given the interplay between dialysate Ca concentra- in a study ofhealth-relatedquality-of-life parameters.17 tionsandmedicationadministrationwithregardtoserum The more recent introduction of Ca-free binders, with Ca and phosphate control, changes in the practice of a decrease in the overall intestinal Ca absorption, phosphatebinderprescriptionareimportantinproviding nowaltersthebalancetowardanoverallnegativeCaload theoptimalCadialysateconcentration.Morethan80%of with the potential to stimulate PTH production. There- alldialysispatientsaremanagedwithphosphatebinders, fore, a trend toward the use of higher concentrations Ca-based agents previously being the most predominant of dialysate Ca has been recommended to avoid Ca worldwide;19 however, the most recent DOPPS data depletion and 1.5mmol/L Ca bath has subsequently (2002–2004) revealed that 25.9% of patients were tak- become more accepted for the majority of HD patients. ingtheCa-freebindersevelamer,comparedwith0.1%of This level seems to be suitable because the moderately patients using sevelamer during the initial observation negative dialysis balances can be easily counterbalanced period (1996–2001).21 Phosphate binder usage differs by the administration of mild doses of Ca-containing across countries, with currently over half of patients in binders, if necessary, in order to ensure a neutral total the United States and some Western European countries body Ca balance.18 being managed with non-Ca-based binders, although Ca Hemodialysis International2006; 10:326–337 329 Toussaintetal. acetate may still be more cost effective.10 In some coun- Cardiovascular morbidity and vascular tries,non-Ca-basedphosphatebinderssuchassevelamer calcification andlanthanumarenotreadilyavailableduetoregulatory and cost issues. The leading cause of mortality in patients with ESKD is cardiovascular disease.32,33 Compared with the general population,dialysispatientshavea3-to30-foldincrease Dialysis Ca physiology in mortality, depending on the age group examined.33 The diffusion of Ca in HD depends on the Ca gradient This excess in mortality compared with the general pop- between the serum concentration and the dialysate ulation is not explained by the presence of traditional concentration. Studies have shown that when the dialy- cardiovascular riskfactors, anda largecomponentofthe sate Ca is greater than 1.5mmol/L, there is an expected vascular calcification is likely due to the chemical prob- gain in Ca.11,22,23 Losses by convective transport, lem of Ca and phosphate excess. Precipitation of Ca and however, can exceed the amount of Ca gained by diffu- phosphate may be responsible for much of the medial sion22 so ultrafiltration is also an important factor in the arterial calcification and the Ca(cid:1)phosphate product overall Ca balance. Ca mass balance studies have dem- (Ca(cid:1)P) is an independent risk factor for vascular calci- onstrated that generally, providing the patient is norm- ficationandcardiovasculardeath.34Ithasalsobeendem- ocalcemic, a dialysate Ca concentration of 1.75mmol/L onstrated that phosphate levels are linearly and produces a positive Ca balance and a negative balance independentlyassociatedwithall-causeandcardiovascu- is obtained with a dialysate Ca of 1.25mmol/L.23–25 lar mortality in dialysis and predialysis patients.34 Dialysate free of Ca has been shown in one early human Vascularcalcification is not, however, as simple as ‘‘Ca study to produce symptomatic hypocalcemia within the loading’’ with passive precipitation of Ca and phosphate first 60min of dialysis for chronic HD patients 26 when one or more of these minerals are in excess. It is and hypotension can also result from inadvertent use of now recognized that this extra-osseous calcification in a Ca-free dialysate.27 ESKD is an active process involving vascular smooth Ca ions are extremely important in the contractile muscle cell transformation to osteoblast-like cells with process of both vascular smooth muscle cells and cardi- elevated phosphate levels and other as yet unidentified ac myocytes and changes can have significant effects on uremic toxins inducing this differentiation. Only once hemodynamics.28Whetherthiseffectisaresultofchang- mineralization is initiated will alterations in Ca and es in myocardial contractility or mediated through vas- phosphate balance accelerate this process via multiple cular reactivity is unclear. Serum ionized Ca increases mechanisms.35–37 In recent years, several mechanisms duringsessionswithdialysateCaof1.5and1.75mmol/L have been identified to explain vascular calcification in- anddecreasestothelowerlimitsofnormalafterHDwith cluding loss of inhibition, induction of bone formation, 1.25mmol/L. Van Kuijk et al., reported that with the circulating nucleational complexes, and cell death. lower dialysate Ca concentration, there is a significantly An elevated Ca(cid:1)P combination is likely to be a pre- larger decline in blood pressure compared with higher dominant risk factor and Ca alone may also be problem- dialysate Ca in patients with normal cardiac function.29 atic because, in general, a positive Ca balance may This is perhaps related to decreased left ventricular con- promote or accelerate soft-tissue and vascular calcifica- tractility using the lower dialysate Ca. Stable blood pres- tionevenintheabsenceofhypercalcemia.38Duringcon- sureisalsoachievedwiththeuseofhigherdialysateCain ventional HD, a positive Ca balance and a concomitant those patients with impaired cardiac function.30 inflammatory state probably act as co-factors in the HD with a dialysate Ca bath of 1.75mmol/L therefore development of calcifications.39 seems to be a possible strategy for improving hemody- Studies using electron-beam computed tomography namic stability in patients, especially for those with (EBCT)haveaccuratelyand quantitatively assessed coro- cardiac impairment.31 This therapy, however, is limited nary artery calcification with total calcification scores bytheconcernsofdevelopinghypercalcemiawithresult- proven to be strongly predictive of coronary artery athe- antexcessiveCaloadsexacerbatingvascularcalcification. rosclerosis and of major future adverse cardiac events in The recent introduction of calcimimetics, as well as thegeneralpopulation.40,41InthosepatientswithESKD, the widespread use of Ca-free phosphate binders, may calcificationscoresarealsomarkedlyincreased,especially providetheopportunitytouseahigherdialysateCacon- atayoungerage,andprogressmorerapidly,althoughthe centration without the effect of predisposing cardiovas- prognostic significance of EBCT in this population has cular mortality (Table 1). only recently been investigated.16,42–45 330 Hemodialysis International2006; 10:326–337 Dialysatecalciumconcentration The presence and extent of vascular calcification in cluded that the effect of serum Ca on blood pressure was ESKDisconsistentlylinkedtoanincreasedriskofdeath. through left ventricular(LV) stroke volume and output. Modalitiesfordeterminingthedegreeofcalcification,in- It has been postulated that an increase in serum-ion- cluding plain radiography,45 ultrasound,46 and EBCT,44 izedCaduringHDcouldalsopotentiallyleadtoimpaired haveallcorrelatedgreatercalcificationwith poorerprog- LV relaxation. However, using a dialysate Ca concentra- nosisandshownthatvascularcalcificationisastrongand tion of 1.75mmol/L one study showed that perhaps this independent predictor of cardiovascular and all-cause wasnotnecessarilythecase,revealingnochangeinDop- mortality in HD patients. The administration of Ca-con- plermeasuresofLVdiastolicfunctionwithanincreasein taining phosphate binders is associated with progressive serum Ca after 1hr of HD without ultrafiltration.55 In- coronary calcification but correlation between dialysate stead,changesintheseLVparameterswerethoughtmore Ca levels and EBCTis yet to be determined. likely to be related to preload. Hemodynamic stability on dialysis Renal bone disease Serum-ionizedCalevelsareadeterminantofvasoconstric- AllpatientswithESKDwillhaverenalbonediseasebythe tion; therefore, alterations in dialysate Ca concentration time they require dialysis. On dialysis, this does not im- may impact on arterial compliance. One study looking at provebutprogressesandinHDpatientsrenalbonedisease the effect of treatment with lower dialysate Ca revealed isaseriouscomplicationthatcanresultinfractures,bone favorable changes in blood pressure and arterial compli- pain, and extraosseous calcification. Several different fac- ance as well as a reduction in serum aldosterone levels torscontributetobonediseaseandaspectrumexistsfrom (amarkerofvasoactivity).47However,cardiacarrhythmias high bone turnover disease, related to secondary HPT, to are also more likely to occur in HD patients with lower low bone turnover disease due to osteomalacia or ady- dialysateCaassociatedwiththepotentialforworseningof namicbonedisease,thelatteraresultofaluminumtoxicity QT prolongation.48,49 ormorecommonlyovertreatmentofHPTwithvitaminD. Intradialytic hypotension remains a problem in HD Clinically, the distinction between these pathological andtheetiologyismultifactorial.Asoutlinedearlier,one diagnoses is often based on the serum PTH level. Para- predisposition has been low dialysate Ca and one study, thyroid hormone levels of less than 11pmol/L (100pg/ whereHDpatientsunderwentalternatedialysiswith1.25 mL) are suggestive of adynamic bone disease and levels and 1.75mmol/L dialysate Ca, revealed a minor but sta- greater than 33pmol/L (300pg/mL) are indicative of tistically significant reduction in mean blood pressure overstimulatingPTHandhighturnoverbonedisease.Di- with the use of the lower Ca bath.50 Manipulations have alysate Ca has been shown to consistently correlate in- showntoimproveefficacywiththisregardbyusinghigh- versely with PTH and therefore higher Ca dialysate will er Ca dialysate.51,52 More hemodynamically stable dialy- suppress HPTand lower Ca levels will improve turnover sis sessions, without intradialytic hypotension, may be and increase PTH. achievedwithadialysateCaof1.75mmol/Landresultin The diagnostic value of serum PTH levels to predict subsequent improved morbidity. For patients with cardi- accurately the nature of renal bone disease, however, is ac impairment and reduced life-span, the benefits of re- debatable. Levels between 11pmol/L (100pg/ml) and duction in dialysis events could be weighed against the 55pmol/L (500pg/ml) are probably insufficiently sensi- potential long-term effects of a higher dialysate Ca con- tive or specific to diagnose either low or high turnover centration with increases in vascular calcification that bone disease.2 The K/DOQI guidelines suggest that if a may not affect life expectancy. Increasing the magnesium patient with ESKD and serum levels of intact PTH be- dialysate concentration to 0.75mmol/L may also be of tween 11 and 55pmol/L develops unexplained hyper- benefit for a lower (1.25mmol/L) dialysate Ca to reduce calcemia, bone pain, or an increase in bone alkaline the incidence of intradialytic hypotension.53 phosphatase (ALP) activity, a bone biopsy can be useful. Blood pressure may be altered by changes in Ca either The bone biopsy will allow more accurate assessment of through alterations in systemic vascular resistance or the rate of bone formation and bone mineralization and changes in cardiac output, or both. A study of 8 HD pa- will help guide therapy.2 tients with variable dialysate Ca from 0.5 to 2.5mmol/L For patients with adynamic bone disease (low or low- showed changes in blood pressure with alterations in Ca normalboneturnover),theuseoflowerdialysatemaybe levels.54 Higher Ca dialysate augmented cardiac output beneficial. These patients are at a higher risk of cardio- whileleavingvascularresistanceunchanged,soitwascon- vascularmortalityandoftenhavehighCa(cid:1)Pasaresult Hemodialysis International2006; 10:326–337 331 Toussaintetal. Table1 Potential advantages and disadvantages of different dialysate calcium concentrations Dialysate calcium Advantages Disadvantages Lower (1.25–1.5mmol/L) Reduces risk of hypercalcemia Potentialfor negative calcium balance Allows greateruse of vitamin D and and stimulation of PTH calcium-containing phosphate binders Increasein intra-dialytic hypotension Benefitin adynamicbone disease Higher (1.5–1.75mmol/L) Improves hemodynamic stability Greaterrisk of hypercalcemia Suppression of PTH Limits use of vitamin D and calcium Beneficial for bone protection in based binders nocturnal hemodialysis Possible risk of vascularcalcification PTH=parathyroidhormone. ofhighserumCalevels.56InoneprospectivestudyofHD ofalternate1.25and1.75mmol/LdialysateCa(2hreach), patientswithbiochemicalmarkerssuggestiveofadynam- there was a significant reduction in intra-dialytic events, ic bone disease, dialysate Ca was reduced from 1.75 to describedtoberelatedtoanincreaseincardiacoutputwith 1.25mmol/L in patients to assess bone metabolism.57 an ionized Ca-inducedincreasein myocardialcontractility. This demonstrated a significant reduction in Ca(cid:1)P The authors concluded that with the use of profiling, by (5.62–3.95) and an increase in PTH. Parameters of bone individualizing the dialysate Ca concentrations used and resorption (pyridinoline) and formation (bone ALP) alternatingbetween them, there may bean improvement were significantly increased, peaking after 12 months. inhemodynamic stability,while simultaneously reducing Treatment with a lower dialysate Ca may therefore be potential problems with hypercalcemia. potentially advantageous in this clinical setting to stimu- Despite only a small sample size, this study demon- late bone turnover. stratedapossiblestrategytohelp ameliorateintradialytic Anotherstudyreviewing67patients,withthedialysate hypotension,asignificantcauseofpatientmorbidity,but Careducedfrom1.5to1.25mmol/L,alsoanalyzedbone longer-term cardiovascular morbidity and mortality as metabolism and revealed an initial increase in PTH and wellaseffectsonrenalbonediseasehavenotbeenanaly- osteocalcin.58InasubgroupwithinitiallylowPTHlevels zed with Ca profiling. (o11pmol/L), there was an improvement in adynamic bone disease. In those patients with PTH 433pmol/L, Differing dialysis modalities lowering the dialysate Ca also allowed an increase in the dose of vitamin D without consequent hypercalcemia, Nocturnal hemodialysis (NHD) provides longer and po- and a subsequentreduction in PTH. Therefore, reducing tentially more frequent dialysis and has definitely been dialysateCaallowsmoreflexibleadjustmentofvitaminD proven to provide superior phosphate control compared tocorrectmetabolicabnormalitiesofbonerelatedtosec- withconventionalhemodialysis(CHD),9,60withNHDpa- ondary HPT. tients even being able to discontinue phosphate binders. TheeliminationofCa-containingphosphatebindersatthe commencementofNHDhaspreviouslybeenshown,how- Dialysis Ca profiling ever,toleadtoalossofupto8gofelementalCaperweek OnepossibilityofutilizingthebenefitsoflowdialysateCa in oral intake, and so exacerbate Ca deficiency and sec- topreventhypercalcemiabutatthesametimeavoidingin- ondary HPT.61 Increasing the dialysate Ca concentration tra-dialytichypotensiveepisodesiswiththeuseofCapro- correctsthisproblem,withanoverallnetgainofCatothe filing. In a randomized crossover trial, Kyriazis et al., patientwhen using a 1.75mmol/L Ca bath. studied 18 HD patients undertaking 4-hr dialysis with ei- The effects of daily dialysis on Ca balance may differ ther1.25mmol/LCadialysateorwith1.25mmol/Lforthe dependingonwhetherthemodalityisNHDorshortdaily first2hrand1.75mmol/Lfortheremaining2hr,followed (SDHD).61–65 The London Daily/NHD Study examined by a 4-hr session with 1.5mmol/L bath.59 Hemodynamic the effect of dialysate Ca concentration on Ca and phos- effects were comparable between dialysis with either phate metabolism, comparing daily HD (including NHD 1.25mmol/L or 1.5mmol/L, with hypotension toward the and SDHD) with CHD.61 Patients on NHD were initially endoftreatmentsessions.WithHDusingthecombination dialyzingagainsta1.25mmol/LCabathwithdemonstra- 332 Hemodialysis International2006; 10:326–337 Dialysatecalciumconcentration tion of increases in ALP and PTH; predialysis serum Ca serumCalevelsandthereforethiswastherecommended levelsbecamelowerinpatientsonNHDwithinamonth. dialysatetoreduceaccelerationofboneturnoverandsub- This observational study showed that increasing the di- sequent development of renal osteodystrophy. Another alysate Ca concentration in NHD prevented HPT and Japanese study of HD patients also confirmed the neces- bone disease. Those patients on CHD and SDHD still sityofahigherdialysateCatopreventworseningsecond- required phosphate binders and did not become Ca ary HPTwhen sevelamer is used as a phosphate binder, deficienton 1.25mmol/L Cadialysate. Concerns still ex- even with additional active vitamin D supplements.72 ist, though, that higher Ca baths in NHD, however, may Lanthanum carbonate is another newer phosphate potentially contribute to hypercalcemia, vascular calcifi- binder, although initial concerns with its use surround- cation, and subsequently more cardiovascular mortality. edthepotentialabsorptionofthiselementandlong-term Despite the higher Ca levels with increased dialysate accumulationintissues.73Invitro,ithasanticalcification Ca,theCa(cid:1)PisreducedonNHDbecauseofmuchbet- and antiatherosclerotic properties and may be another ter phosphate control and although long-term mortality alternative to Ca-based binders but long-term studies data are not yet available, this mode of dialysis certainly are pending. provides greater improvements in well-being, cardiovas- cular outcomes, and bone metabolism.61,62,66,67 Vitamin D analogs IMPACTS OF NEWER TheprescriptionofactivevitaminDisamajortreatment to correct hypocalcemia and suppress PTH levels in PHARMACOLOGICAL MANAGEMENT ESKD. According to the DOPPS data, 52% of patients were treated with some form of vitamin D therapy.19 Sevelamer and Lanthanum Calcitriol (1,25[OH] D ) and alfacalcidol (1a[OH] D ) 2 3 2 2 Sevelamer hydrochloride is a newer phosphate binder have been predominantly used, administered by an oral containing neither Ca nor aluminum. It is useful for oranintravenousroute,butconcernsregardingtherisks patients requiring better phosphate control and who are of hypercalcemia and hyperphosphatemia have led to also being administered vitamin D metabolites to reduce the emergence of vitamin D analogues that suppress the potential for hypercalcemia. Sevelamer has been PTH without affecting serum Ca and phosphate levels. demonstratedtostabilizecardiaccalcificationandreduce Maxicalcitol (22-oxacalcitriol) and doxercalciferol the rate of progression by avoiding or reducing the need (1a[OH] D )havebeenstudiedalthoughnonehavebeen 2 2 for Ca-based phosphate binders, therefore providing completely successful in avoiding alterations of Ca and areductioninCaload.68TheDialysisClinicalOutcomes phosphate and to date have not been proved superior to Revisited (DCOR) study recently demonstrated that calcitriol and alfacalcidol.74 patientswhousedsevelamerexperienceda9%reduction Paricalcitol (19-nor-1,25[OH] D ) is being more com- 2 2 in risk of death from all causes relative to patients using monly used in the United States, perhaps following the Ca-based phosphate binders over a 2-year period, with retrospective report of reduced mortality in North Amer- mortality influenced by age and duration of treatment.69 ican HD patients taking paricalcitol rather than calci- However, this study did not reveal a significant survival triol.75 No trials as yet have adequately addressed the benefit for the non-Ca-based binder, failing to meet its implicationofthesenewervitaminDagentsinrelationto primary or secondary endpoints and showing no signif- dialysate Ca levels. icant difference in mortality or morbidity with sevelamer compared with Ca-based phosphate binders. Calcimimetics Interestingly, following the initial published literature revealing the advantages of sevelamer, it was emphasized Theintroductionofcalcimimeticagentsintoclinicalprac- by Backenroth, in a letter to the editor, that dialysate Ca tice has also had beneficial effects on serum Ca, phos- was not even included in the study.70 More recently, the phate, and Ca(cid:1)P and have brought increased focus on effects of different dialysate Ca concentrations were as- the increased mortality risk associated with hyper- sessed with the use of sevelamer hydrochloride.71 With calcemia.76CinacalcetbindstoandactivatestheCa-sens- 1.37mmol/LCadialysate,serumCalevelsdecreasedand ing receptor in the parathyroid glands, lowering the PTH levels increased significantly and with 1.25mmol/L threshold for its activation by extra-cellular Ca and di- Ca dialysate, there was even transient hypocalcemia. The minishing PTH release. Again, similar to the initial trials group with a dialysate Ca of 1.5mmol/L had unchanged withsevelamer,dialysateCawasnotconsideredwiththe Hemodialysis International2006; 10:326–337 333 Toussaintetal. earlystudyinvolvingcinacalcetandthereforetheoptimal withLVdysfunctionorfrequentintra-dialytichypotension, dialysate Ca bath to be prescribed in the setting of calci- but with reductions to 1.5mmol/L should hypercalcemia mimetics has not been determined.77 The use of arise. Higher dialysate Ca concentrations of 1.75mmol/L 1.75mmol/L dialysate Cawasassessed ina smallsample mayalsobenecessaryforpatientswhosemedicationlistis of7HDpatients,withadministrationofcinacalcetinpa- free of Ca-based binders and vitamin D supplements, as tients with severe secondary HPT showing reduction in well as for patients with marked secondary HPTand also serum PTH levels and without hypercalcemia.77 those undertaking NHD, although the long-term risk of vascularcalcification needs exploration. Adjustment to the dialysate Ca concentration can Recommendations change the overall Ca balance to maintain appropriate Recent changes in the management of mineral metabo- serum levels of Ca and phosphate and therefore reduce lism in patients with ESKD have placed more emphasis the risks of renal osteodystrophy and cardiovascular dis- on the concentration of Ca in dialysate. A dialysate Ca ease.DialysateCaconcentrationshouldbemeasuredand concentration of 1.25 to 1.5mmol/L is often the most taken into consideration in all studies analyzing serum appropriateforHDpatients.ThenegativedialysisCabal- Ca,calcification,andmineralmetabolisminHDpatients, ance is countered by the oral administration ofCa-based and as mentioned more research is warranted to deter- phosphatebindersand,ifnecessary,theuseofvitaminD mine the optimal dialysate level. analoguesformanagementofsecondaryPTH.Thisallows an overall neutral total body Ca balance.78 A newer strat- Response to clinical scenario egyofre-emergingaluminum-basedphosphatebindersin some countries andmoreimportantly aluminum-free and With regard to the initial clinical scenario, the predom- Ca-freebinders,suchassevelamerandlanthanum,world- inant aim for this patient would be for better phosphate wide, can be used for more optimal control of hyper- controlandgreatersuppressionofPTH.Atthesametime, phosphatemia without the excessive Ca load and the risk carefulmonitoringofserumcalciumandCa(cid:1)Pisequal- ofexacerbating vascularcalcification. With this strategy, it ly important to reduce the overall cardiovascular risk. If maybenecessarytoadjustupwardsthe dialysate Cacon- sevelamerisnotavailable,areductioninphosphatecould centration with the re-introduction of 1.75mmol/L be achieved through (i) the use of longer, more frequent dialysate Ca to avoid problems with secondary HPT. The dialysis such as NHD, (ii) stricter dietary phosphate re- useofnoncalcemicvitaminDanaloguesandcalcimimetics strictions,or(iii)theadditionofmorephosphatebinders, also allows for higherdialysateCa baths. possibly extra aluminum hydroxide. The decision to use a certain dialysate Ca should be Lanthanum would also be effective as a noncalcium- made with results of Ca loading or depleting during di- based phosphate binder, although regulatory restrictions alysis in association with information regarding the oral and cost issues in some countries may limit its use if Ca intake allowing an even total-body Ca balance. The sevelamer is unattainable as well. If there are concerns type and degree of renal bone disease and the associated about aluminum toxicity with aluminum-based binders, cardiovascular co-morbidities should also influence the anincreaseinCa-containingphosphatebinders(increas- individualizeddialysateCalevel. Biochemical markers of ing the currently prescribed calcium carbonate to 3 tab- renal bone disease should be a consideration as a lower lets,3timesdaily)couldbeanoption;however,thereisa dialysate Ca concentration may be an advantage to those further risk of exacerbating hypercalcemia. The dialysate HDpatientswithadynamicbonediseasetoincreasebone calciumconcentrationinthissituationshouldbelowered formation and resorption. Cardiovascular status should and a dialysate calcium level of 1.25 to 1.5mmol/L is be appreciated when choosing dialysate Ca baths, both probablymostappropriate.Withtheuseofa1.25mmol/ with the attempt at reduction of accelerated arterioscle- L Ca bath, there may be an overall negative Ca balance rosis as well as providing hemodynamic stability if there potentially worsening hyperparathyroidism (HPT). is a degree of LV dysfunction. Reducing serum phosphate should also help manage Recommendations are that patients taking Ca-based secondary HPT. Noncalcemic vitamin D analogues would phosphate binders should be dialyzed against Ca of 1.25 probablynotprovideanyadditionaladvantagetothecur- to1.5mmol/L.Lowerdialysateconcentrations(1.25mmol/ rentlyprescribedcalcitriol,althoughparicalcitolmayprove L)shouldbeusedifadynamicbonediseaseexistswithlow in further studies to reduce hypercalcemia, vascularcalci- PTH levels. Dialysate concentrations of 1.75mmol/L may fication, and subsequent mortality and therefore may be beusedtoimprovehemodynamics,especiallyforpatients morebeneficial.Theadditionofacalcimimeticagent,like 334 Hemodialysis International2006; 10:326–337 Dialysatecalciumconcentration cinacalcet,wouldbeanotherpossiblemanagementoption 11 Malberti F, Surian M, Poggio F, Minoia C, Salvadeo A. tolowerPTHwithouttheriskofincreasingserumcalcium. Efficacy and safety of long-term treatment with calcium Theoptimaldialysatecalciumconcentrationswiththeuse carbonateasaphosphatebinder.AmJKidneyDis.1988; of cinacalcet and paricalcitol have not been determined 6:487–491. 12 Argiles A, Kerr P, Canaud B, Flavier J, Mion C. Calcium although higher levels would most likely be necessary. kinetics and the long term effects of lowering dialysate If the dialysis modality was changed to NHD with an calcium concentration.Kidney Int. 1993; 43:630–640. improvement in hyperphosphatemia and withdrawal of 13 FernandezE,BorrasM,PaisB,MontoliuJ.Low-calcium phosphate binders, then 1.75mmol/L dialysate calcium dialysatestimulatesparathormonesecretionanditslong- may be beneficial. This strategy would avoid total body term use worsens secondary hyperparathyroidism. J Am Ca depletion, and subsequent worsening HPT, but still Soc Nephrol. 1995; 6:132–135. likelyreduceCa(cid:1)Pbecauseoftheimpressivereductions 14 Argiles A, Mion C. Low-calcium dialysate worsens sec- in serum phosphate. ondary hyperparathyroidism. J Am Soc Nephrol. 1996; 7:635–636. Manuscript received February 2006; revised April 2006. 15 ShermanRA.Onloweringdialysatecalcium.SeminDial. 1988; 1:78–79. 16 Chertow G, Burke S, Paolo R. Sevelamer attenuates the REFERENCES progressionofcoronaryandaorticcalcificationinhemo- dialysis patients. Kidney Int. 2002; 62:245–252. 1 Palmer B. Individualizing the dialysate in the hemodial- 17 Taji Y, Morimoto T, Fukuhara S, Fukui T, Kuwahara T. ysis patient. Semin Dial. 2001; 14:41–49. Effectsoflowdialysatecalciumconcentrationonhealth- 2 National Kidney Foundation. K/DOQI clinical practice related quality of life in hemodialysis patients. Clin Exp guidelines for bone metabolism and disease in chronic Nephrol. 2005; 9:153–157. kidneydisease.AmJKidneyDis.2003;42(Suppl3):S1– 18 MalbertiF,RavaniP.Thechoiceofthedialysatecalcium S202. concentration in the management of patients on hemo- 3 JohnsonWJ,GoldsmithRS,BeaboutJW,JowseyJ,Kelly dialysis and haemofiltration. Nephrol Dial Transplant. PJ, Arnaud CD. Prevention and reversal of progressive 2003; 18(Suppl 7):37–40. secondary hyperparathyroidism in patients maintained 19 Young E, Albert J, Satayathum S, et al. Predictors and by hemodialysis. Am J Med.1974; 56:827–832. consequences of altered mineral metabolism: The dialy- 4 Slatopolsky E, Weerts C, Lopez-Hilker S, et al. Calcium sis outcomes and practice patterns study. Kidney Int. carbonateasaphosphatebinderinpatientswithchronic 2005; 67:1179–1187. renal failure undergoing dialysis. N Engl J Med. 1986; 20 Locatelli F, Cannata-Andia J, Drueke T. Management of 315:157. disturbances of calcium and phosphate metabolism in 5 Slatopolsky E, Weerts C, Norwood K, et al. Long term chronicrenalinsufficiency,withemphasisonthecontrol effects of calcium carbonate and 2.5mEq/L calcium di- of hyperphosphataemia. Nephrol Dial Transplant. 2002; alysateonmineralmetabolism.KidneyInt.1989;36:897. 17:723–731. 6 SawyerN,NoonanK,AltmannP,MarshF,Cunningham 21 YoungE,AlbertJ,AkizawaT,etal.Sevelamervscalcium- J. High-dose calcium carbonate with stepwise reduction containingphosphatebindersandmortalityintheDial- in dialysate calcium concentration: Effective phosphate ysis Outcomes and Practice Patterns Study (DOPPS). J control and aluminium avoidance in hemodialysis pa- Am Soc Nephrol. 2005; 16:47A. tients. NephrolDial Transplant.1989; 4:105–109. 22 BinswangerU.Calciumfluxduringhemodialysis.Semin 7 VanderMerweW,RodgerR,GrantA,etal.Lowcalcium Dial. 1990; 1:1–2. dialysateandhigh-doseoralcalcitriolinthetreatmentof 23 ArgilesA,MouradG.Howdowehavetousethecalcium secondaryhyperparathyroidisminhemodialysispatients. in the dialysate to optimize the management of second- Nephrol Dial Transplant. 1990; 5:874–877. ary hyperparathyroidism. Nephrol Dial Transplant. 1998; 8 Llach F, Yudd M. Pathogenic, clinical and therapeutic 13(Suppl 3):62–64. aspectsofsecondaryhyperparathyroidisminchronicre- 24 Malberti F, Surian M, Minetti L. Dialysate calcium con- nal failure. Am J Kidney Dis. 1998; 32:S3–S12. centrationdecreaseexacerbatessecondaryhyperparathy- 9 MucsiI,HerczG,UldallR,OuwendykM,FrancoeurR, roidismindialysispatientsgivencalciumcarbonateasa Pierratos A. Control of serum phosphate without any phosphate binder. J Nephrol. 1991; 2:75–81. phosphate binders in patients treated with nocturnal 25 Fabrizi F, Bacchini G, Di Filippo S, Pontoriero G, Lo- hemodialysis. Kidney Int. 1998; 53:1399–1404. catelliF.Intradialyticcalciumbalanceswithdifferentcal- 10 NolanC,QunibiW.Treatmentofhyperphosphatemiain cium dialysate levels. Nephron. 1996; 72:530–535. patients with chronic kidney disease on maintenance 26 ErmakovaI,NovikovA,PronchenkoI.Useoftheequip- hemodialysis. Kidney Int. 2005; 67(Suppl 95):S13–S20. ment for hemodialysis in the diagnosis of calcium me- Hemodialysis International2006; 10:326–337 335
Description: