ebook img

Ragamala paintings: a musicological perspective PDF

9 Pages·1992·0.33 MB·English
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Ragamala paintings: a musicological perspective

Ragamala Paintings: A Musicological Perspective* ASHOK D. RANADE Ragamala paintings inevitably attract an interdisciplinary examination. It would notbe far-fetched to suggest that ragamala paintings, chitrakathis, pabuji-ka-pad,and theyamapattakasorpatsfromPuri,etc.are representa tiveIndianattempts to bringtogetherthe visualandaural modalitiesandtoevolve artforms thatcombinemusic,painting,andliterature ordrama. Threecategories ofarts-performing, fine, andliterary-joinforceshereandthesituationbecomes challengingly complex. Ragamala paintings display a capacity to raise q'{estions germaneto manyareas ofIndian studiessuchasiconography,literature, prosody, mythology, and folklore. The present inquiry, however, draws on the three music-relateddisciplinesof musicology,musicalaesthetics, andculturalmusicolo gy. I do not claim that the approach registers a radical departure. The available literature on ragamala paintings wouldclearly refute such a claim. For example, ragamala paintings have been perceptively analyzed to tackle the musicological problem of raga-classification. They have also been repeatedly discussedin the a contextoftherasatheory vis vismusic.Finally,therelevanceandcausationofthe paintingshaveinterested many students of the broader cultural frameworkof this country. In other words, the aim of my presentation can only be to assert a continued relevance of the audio-visual experience that ragamalas impart. Thequestionsthat the three disciplinesraiseare ofa kindthatdemand renewed attention from each generation. Thisisinevitableas these disciplinesare directly related to the performing tradition of music. For example, the musicological questionshavea bearingon the technique andgrammarofmusic-making. On the other hand, musicalaestheticsshoulders the responsibilityfor judgingthe quality and value of the expenence involved. Cultural musicology regards music and culture as mutual dependents and hence accepts the necessityof considering all musicalevents afresh when cultural changes are perceived as such. In sum, the scene is likely to remain exciting so far as ragamala paintings are concerned! Experts agree that ragamala paintings, though barely 400 years old, have musicological antecedents. The most notable has been the role allotted to the human figure as an icon, as an active agent employed to concretize musical speculations_In thiscontext the all-pervasivePurusbs conceptclaimsaconceptual priority. Al itsmostabstractand metaphysicallevel,theconceptislinkedwiththe act of creation. As Dr Kapila Vatsyayan has pointed out, "The Absolute • ThisarticleisbasedonatalkfortheMohite-ParikhCentreforVISualArts.deliveredattheNational Centre (or the Performing Arts. Bombay. ScDgmN.WtNo. 103:January-March1992 4 ASHOK D. RANADE Primordial (Purusha) gives rise to the individual archetype (purusha)", which is instrumental in creating all the products of the bhutas-i.e. beings-through the aid of sounds and words. The ancient sankhya philosophers held that Purusha is witness to the creative activities of Prakriti. He is tata-stha while the stream of creationflowson and by.A little more directisthe tradition ofcomparingmusicto thehumanbody and statingequivalencesbetweenmusicalnotesand bodilyorgans, etc. (e.g. sa=soul, re =head,ga=arms, ma =chest). Atyet anotherlevel, music isunderstood asone limb of the larger conception of the arts seen as the Body of Man with many interrelatedsystems. Finally,musicological texts openspeculations on the science of music by describing the physical and biological foundations of human life as a prelude to its more technical deliberations. However, these comparatively abstract formulations are inadequate for the visualization inherent in the act of painting. It is here that the very early Indian customoffindingwide-rangingnon-musicalcorrelatestomusicalfeaturesmakesits contributionfelt. For example, the correlatesfrom Bharata's Natyashastra can be tabulated asshown inTable 1.TheNaradiya Shiksha moves a step forward inthat swara is equated with varna (Table 2). By the time we moveto amusical landmark, the Sangha Ratnakara,matters are obviously heading towards firm visualization as well as personification processes (Table3,p. 6). However, asGangolyperceptivelynoted, "eventhoughRatnakara allots protective deities for melodies as distinct from individual swaras, their pictures or images are not described...in any prayer-formulas in the shape of descriptiveverses (dhyanas) suchaswefind inthe latertexts" (RagasandRaginis, p. I06). Most authorities seem to agree that dhyanash/okasare not found priorto the Ratnakara. According to Dr PremlataSharma, the Sangitopanishadsar(1350) of Sudhakar, a Jain musicologist, is the earliest work to have dhyanash/okas. (Incidentally,ChaitanyaDesai hassignificantly referredtoSudhakar'suse ofdance terms traceable to Rajasthani languages and dialects.) Gangoly however gives credit to the Panchama Sara Samhita of Narada, dated circa 1440, for the appearance of both ragasand raginis and dhyanash/okas. More importantly, the text of the dhyanash/okas-even in the later Sangitaraja of Kumbha, again from Rajasthan (1433-68)-is to be marked for the resemblance ofthe dhyanas to the tantric dhyanas. This ostensibly isthe reason why the following and similar terms occur frequently in the early dhyanash/okas: pasha (lasso/noose), pha/am (fruit), abjam (thousand-petalled lotus), japama/ika (rosary), veena (lute), padmam (lotus), ankusha (goad), shankha (conch), chakram (wheel), gada (mace), abhayakaram (a tantric mudra), etc. To anticipate a little, the dhyana concept neededto be replacedbythenayaka-nayika bheda inpreparationfor theadventof ragamalas. Itisalso helpfulto note that dhyanash/okasare mostly relatedtogramaragasas distinct from deshi ragas. The former kind belonged to margisangeet, i.e. sacred music. On the otherhand, deshi ragasbelonged to deshi sangeeta which has been succinctly defined in the Ratnakara as "the sangitacomprisinggitam, vadyam and nrittam, that entertains people according to their tastes in different regions". TABLE 1 Bharata's Correlatives Rasa Shringara Hasya Karuna Roudra Vira Bhayanaka Bibhatsa Adbhuta u.: '" 'i'IR m>:I ""'" <fu: "'""" '""'" """" Bhava Rati Hasya Shoka Krodha Utsaha Bhaya Jugupsa Vismaya "'" <fu m>:I "Wi; "'" ~ "" ~ f<>l'l'I Varna Shyama Sita Kapota Rakta Gsure Krishna Nila Pi:;. -.uf l'l1'l fl!1I .,;rn «li >iR 'l"'I '"'" <1m Lightgreen White Grey Red Yellow-red Black Blue Yellow .. Devata Vishnu Pramatha Yarna Rudra Mahendra Kala Mahakala Brahma ~ f<lml """ "" 'lR "'" llm"'" "'" TABLE 2 Correlatives in Naradiya Shiksha Shadja Padmapatraprabha Brahmin ~ """""" Lotus-petalred Rishabha Shukapinjara Kshatriya Wrq ~ Reddishyellow Gandhar .K..a..n.a..kabha Half-Vaishya '""" Goldenred Madhyama Kundasaprabha Brahmin ""'" ~ White Panchama Krishna Brahmin """ 'l"'I Black Dheivete ['jeaka Kshatriya ,j,.. ,;m; Yellow Nishada Servsveme Half-Vaishya f.I'lIO: wl-.uf All(multij-coloured TABLE 3 Sharangdeva's Correlatives Swara Shadja Rishabha Gandbara Madhyama Panchama Dhaivata Nishada om m ~ !ml 'li'lR ""'" """ Rom: Varna Rskts Pinjara Swama Shubhra Krishna Pita VlChitra 'I"f "(if; lim 1'1"1 ~ 'l"'l '"" film Alipil3 3!fu<itlI Dcvets Vanhi Brahma Chandra Vishnu Narada Tumburu Tumburu ~ 'If.; ~ ~ f<l"l "'" lR' -iRi Rasa Vira Vira Karuna Hasys Hasya Bibhatsa Karuna '" '"' >ill ~ ~ ~ .r.,., Adbhuta Adbhuta Shringara Shringara Bhayanaka """" """" ~ !j>TR """'"' Roudra Roudra m:: m:: One may wonder about the actual link between the ragadhyanas and their performance. Gangoly, Ebeling, and many others have suggested that the forms were intended to be used byperformers in order to capture and comprehend the divinequalitiesofmusicandthat theyare thusto bedescribed asprayer formulae. Perhaps one should ponder a little over the concept of dhyana. The term is derived from ,"', to meditate upon, imagine, call to mind. Dhyana is a mental representation ofthe personal attributesof an image,traditionallyofa deity. The concept has been developed by the Vedanta, Sankhya, Buddhist and Yogic thinkers in their own ways. Dhyana has been inevitably linked to the divinity concept interpreted according to the general thrust of the philosophy concerned. The Yogicand, to someextent,the Buddhist interpretationiscomparativelymore spiritual, psychological, and philosophical than theological. For example Patanjali definesdhyanaas"""11<"~"'dH'" "IR1('. Without goinginto highlytechnicaldetails the process could be described as the arrest of the march of those otherwise evanescenl impressions received fromanythingselected asastimulus-support and the consequent stabilization of a particular impression. Dhyanaconstitutes one of theeightaspectsofPatanjali'syoga.Itcanbeessentiallycharacterizedasavictory over time because dhyana denies successive moments their customary power of destroyingthe experienceofallearlier momentsandthusbringingabout astateof continuing instability. Ooe importantcomponentofthe procedure is3lR'P'R'I, i.e. supportivestimulus.Itisthe mentalexercisepractisedbyyogisinordertostabilize in the mind selected grosser forms of the eternal. Developed over the course of centuries, dhyana proceduresandtechniques consistof two major types knownas saguna and nirguna. The distinction between the two is that the latter involves RAGAMALA PAINTINGS 7 concentration on abstract qualitieswhilethe former employsconcreteobjects etc. A later Upanishad (Dhyanabindopanishad), devoted exclusively to the dhyana phenomenon, significantly mentions Brahma, Vishnu, Rudra, Maheshwar and Achyut as the main icons and the sounds of the Veena and Shankha as the revelatorytimbres.The Buddhistsmadethe conceptsoaccomodativeasto include ordinary objects as well as ashubhas (inauspicious things) as supportive stimuli. I have dwelt on the dhyana concept at some length to suggest that the ragadhyanas need to be understood as cumulative musicological and multi channelled efforts to shift music away from the preemption of the sacred. The dhyanaphilosophy, the psychological procedures involved in it, the techniquesit perfected towards religio-metaphysical ends-all were skilfully assimilated and adapted by medieval Indian musicology because music, music-makers, and music-receiverswereundergoingatotal changeduringtheperiod.Oneofthe basic principlesofcultural musicologyholdsmusictobethe mostreluctant culturalfacet to accept change (and consequently the last to accept and exhibit change). However, music isalso the mostsymptomaticofdeeperculturaltransformations. Whenmusicchanges,everythingcanbeassumedtohavechanged.Theascendency of the deshi element in the middle ages thus indicates comprehensive religious, linguistic,demographic, political,and aestheticchanges that the Indian ethoswas keentoassimilate. Asanaidintheprocess,non-representationalexpressionsuch asmusicwouldneed representational strategicapplications,andragadhyanaswere devised with this end in view. Sharangdeva in his Sangita Ratnakara spoke perceptively of poorvaprasiddha and adhunaprasiddha ragas and thus drew attention to noticeable changesdemandinga newsystematization. Itisinteresting to note that though he reorganized the prevailing raga corpusby employing the original-and-derived format, there is no indication of the ragini concept being in vogue. Derivative ragas were not called rsginis. Thus we reach the crucial span of the 16th-17th century, the period which producedtwo major worksdirectlyrelated to ragamalas: KshemakarnaIMeshkar na's Ragamala(1509)and Pundarik Vitthala's Ragamala(1576).The workslisted raga-ragini-putra families, gave the descriptive verses, and followed them with pictures. Obviously the raga corpus had grown enormously since the times of Sangita Ratnakara. The concept of putra was therefore pressed into service to accommodate the new entrants. Onee again the authors came from the Rajastban-Malwa region. The accumulated influx of new ragas during the three centuriesproved challenging to musicologists and musicians alike. Fortunately a number of major musicologists appear to have been performers and this saved themfrom beinginitiators ofdessicated theoreticalformulations. It issignificant to note that Pundarik Vitthala not only includes as many as 16Persian ragasin his familyof66but alsomentions their nearest Indianequivalents. Hedoesnot failto clarifythatthe Persianragasareparada(giftedbyothers) butacceptsthemwithout further ado!Pundarik Vitthala wasaSouthernerwhocame to theNorthinsearch ofpatronage.He isreportedtohavewrittenonHindustanimusicand danceatthe behestofhispatron.ThetwoworksofKshemakarnaandPundarikVitthalaarethe acknowledged foundations of the ragama/as. However, discussion of the estab- 8 ASHOK D. RANADE lishedragamalaconvention cannotbetakenupunlessaninterveningphaseistaken into account. The reference isto the Kalpasutra manuscripts dated late 15thcentury. Ebeling admitsthat theKalpasutra Ragamalaisthe earliest, yetconcludes thatit is"a dead end road interms ofpictorialragamala-s". Even ifone accepts hisjudgement,the otherillustrationsfromthesameJainsourcemeritseriousnoticeforeverycultural consideration. The manuscript illustrations deal with very fundamental musicolo gicalconceptssuchasgrama, swara, shruti, murchhana andlana. Forthepresent purpose some features of these 107 illustrations (described by the editor alternatively as chitravaIi or sangita-rupavah) are worth noting: 1. All the illustrations have only one figure in the picture-space and the titleis inscribed at the top. 2. Animals and birds finda place frequently but the commonformat isa figure with a human body and an animal head. 3. The highlytechnical concepts depicted in the series closely followthe stated musicologicaltradition. For example, the tana-visualizations include animalslbirds because different tanas begin successively on different notes in sequence andthe notes themselves have been associated with the calls of certain animals or birds according to the musicological tradition. 4. It is surprising that even though the chitramala proceeds to include illustrations on dance, the concept of tala is not even touched. 5. Altogether the series depicts 15musical instruments-none ofwhichsounds an unfamiliar note! The undiluted musicologicalorientationofthe seriesisremarkable. Ontheother hand the Kalpasutra Ragamala includes ayudha (weapons), mudras, and other visualforms that echo the Yaksha-Yakshini or Gandharva-Surasundari figuresof temple sculpture. According to ragamala experts the Kalpasutra effort is at least a century away from the reallyimportantragamalas. As amusicologist1feel it represents amajor step towards the mainstream ragamaJa tradition since it reflects the incipient conceptual decision of the artiststo deny a one-to-one correspondence between musicalandvisualphenomena.Thisiswhat made the laterragamalaspossible.The Kalpasutra indicatesakindofbreakingaway,aliberation from aconventionwhich was ambitiously comprehensive-attempting as it did to encompass too many details and perhaps hamper the freedom of performance so essential to music. Leaving aside this larger issue, it might be said that the Kalpasutra Ragamala, though nearer to ragadhyanas than to the pictorial ragamalas that came later, represents a necessary and a logical step towards them. At thisstagealittlediversionneeds to bemade bygoingbacktothe ragadhyanas and especiallytheir relation to the performing tradition. Is itsufficient todescnbe the dhyanasasprayer formulae to express their link with the performing tradition of Hindustani music? Perhaps in this respect the net has to be cast a little wider. RAGAMALA PAINIlNGS 9 A look towards the Vaishnava tradition of musicin Assam and adjoining areas seems advisable. This is logical because the ragamala traditions and Vaishnava musicology both leaned heavily on the Sangita Damodara (1500 A.D.) of Shubhankara. Authorities on Assamese and Manipuri music refer to the actual singingofragadhyanasafter the initial alapawhichtoo isnot setto rhythm (Neog and Changkakoty 1962, Darshana Jhaveri and Kalavati Devi 1978).In fact the former twoauthorsassertthatraga-visualizationseemstohaveprevailedinAssam from medievaltimesintheformknownasrege-mslits. Thesameauthoritiesstate that Rama Saraswati, a contemporary of Shankaradeva (1449-1598), used the expression raga-malita inhisGeeta Govinda anddescribed itasragadhyanawhile he took the musical contents of his compositions from Shubhankara's Settgite Damodara. Further, the authors drawattention tothe significantfactthat popular raga-malitas differfrom the ragalakshanasofthe Sanskrit treatisesincludingthose oftheSangita Dsmodsrs, Veryoften themalitasdonotgivepersonifiedpicturesof ragasbutlinkthem withsomeincidentinthelifestoriesofKrishnaorVishnu.Both these features suggestan independent, early, popular and secularevolutionofthe eoncept ofragadhyana asa performance feature. The similaritybetween the two termsragamalaandraga-malitaisalsoobvious.TheAssamesepracticecouldraise many questions about the accepted statements on the origin, period, provenance and raison d'etre of the ragamaJas as a musical phenomenon. Yet another instance of regional variation of some significance is the Nasik Ragamala brought to our notice by M.S. Mate and Usha Ranade in 1982.The series is incomplete and consists of only 44 paintings. The set is based on Kshemakarna's Ragamala and displays interesting similarities and deviations. Dated 18thcentury, the seriesshowsaremarkablelocaltouch inthe physiognomy of human figures, dresses, ornaments, general decor and architecturalsetting. Even in the incomplete version, the inclusionof Jogi-Asavari in the raga corpus mayprovesignificantinviewofthefactthatJogi-Asavari, likeGauri, iscommonin the non-elite musical traditions of Maharashtra. Maharashtra is also credited to have originated a series of pictures on talas painted in the Deccan in the late 18thcentury. Whatever may be the verdict on their pictorial worth, the paintings undoubtedly arouse musicological interest. Inthemusicologicaltradition talahasneverbeenregarded aslessimportantthan raga. A pictorial tradition fullyresponsive to the musicologicalcontinuity would logically be expected to reflect the tala aspect of Indian music as well. It is interesting to note that to the ancients tala was an action-reaction of the two opposingprinciplesofpurushaandprakriti, ShivaandShakti. Almostpredictably, ta has been equated with Shivaand la with Shakti. One might recall the tandava dance of Shivaand the lasya expression of Parvati. Against this background the Deccan attempt, however isolated and weak, needs to be appreciated as a correction introduced to rectify the musico-pictorial imbalance conventionally present in ragamala paintings. When one remembers that even the pioneering Kalpasutra tradition did not touch tala (though it dealt with dance), the contribution of the Deccan tala paintings assumes added value. Usha Ranade and Kamal Chavan, the editors of the monograph on the tala 10 ASHOK D. RANADE paintings, have argued Ihal talaisdifficultto portraybecause ofitssecondary role ingenerating arasa.They have also rightly drawn attention to the fact that talais distinct from layaand that it is the latter which is rightfully associated·withrasa. Whether it is the early and seminal Vishnudhannottara Purana or the later Sangitarajaof Kumbha, the emotive aspect of musicisclearly associated withlaya ratherthan tala.But thisonlytakes the argumentfartherback!Thequestion which could then be raised is: Whyisa pictorial representation of layanot found inthe tradition? Perhaps the answer lieselsewhere and needs to sought after some more ground has been covered. Once again a look at North-eastern music-making may prove rewarding. It has been recorded bystudents of Manipuri dance and musicand those of Vaishnavite rhythmic expression in Assam that Pung and Khol arc played to realize musical forms described as ragas. In the Manipuri presentation this specific form is reportedly known as ahoubi.In a similar fashion the raga-diya (presentation ofa raga) in the Assamese tradition includes raga-talaniwhich has no reference to the tala/talas actually used in the performance of the Geet which follows later. The raga-talaniinfactconsistsofplayingcertainpataksharasinadefinitesequence. Itis thought-provokingthatthe oft-quoteddefinitionofraga-ranjayatiragah-hardly makesthe exclusiveuseofmusicalnotes inevitable! Ifone considers the traditional shabda-nada-dhvani-vamahierarchyitiseasyto followthe logicof havingragasof the Mridanga or anyotherinstrument-with no mandatory rolefor musicalnotes. The point is that ragamala paintings did not aim at reflecting the musicological tradition-atleast not afterthe early dhyanaphase wasover. In fact,itdidnot use musiceven as its stimulus!It became what it is because it worked within its own pictorial tradition. The tradition, it appears to me now, is more theatre-oriented than music-oriented. This is the reason whythe early Kalpasutra attempt withits heavy musicologicalbias was not followed up.The twoother controlling contents of the ragamalas are known to be the nayika-bhedadoctrine and the Krishna-lila literature. It is necessary to remember that nayika-bhedaas propounded in the Sanskrit traditionwaspart ofthe rasatheoryinwhichshringarawasdominant.The Krishna-lila concept accepted the rasa system but processed it with allegorical devotion through the literature of Jayadeva, Vidyapati, Surdas, etc. It is also important to note that Rupa Goswami's UjjwalChintamanibrought into beinga comprehensive bhakti-orientedVaishnava theoretical structure to add an invalu able dimension to the Hindi literary tradition. I suggestthat it isthe theatre-inspired rasa system which provided a foundation forragamalapaintingswhilethe nayika-bhedaaspropoundedinthe Hinditradition helped.to determine their content. The avatara concept has always proved conducive to theatricexpression because it creates roles and not characters alone. In addition, the Krishna-lila proved to be an apt formula for humanizing abstractions inherent in conceptual structures in the rasa theory, literary sophistications in the nayika-bheda, or philosophical subtleties in the avatara concept. Itisagainst this background that wecan appreciate many components of ragamala paintings: for example love as the sthayi-bhava; nayaka-nayika as the alambana-vibhavas; friends/messengers and natural surroundings as uddipana· RAGAMALA PAINTINGS 11 vibhayas; alankaras and hevss of the personages as anubhayas; and finally the expressionsandfeelingsdepictedasthessncheti-bbsvss.Thisisthereasonwhythe musicologicalauthenticitygetsweakerandweakeraswemovefromoneragamala to theother. Meshakama and hisfollowersrepresent musicalimpulsestaken over by theatric ideas struggling to give expression to artisticinterest in mundane (as distinct from divine and profane), secular (as distinct from sacred), and action-oriented (as distinct from contemplative) theme and content, In addition, therewasthe urge toarticulateregionalinsteadofpan-Indianfeatures.Thus,while the musical labels continued, the content underwent a radical change. The true significance of the ragamala phenomenon would be lost if we continued to be guided by the labels. • For a musicologist ragamala paintings could pose the following questions: 1. Why is it that there are no ta/ama/as? 2. Whyisit that the Camaticsystemofmusicdoes not enjoythisextra-musical but music-related art expression? 3. Where did the basic loyalty of the ragamalas lie-in the performingor tile- scholastic tradition of music? 4. Inviewofthe categorial pentad ofIndian musicalexpression,isitpreferable to examine ragamala paintings with a set of criteria other than the customary historico-rnusicological? 5. Indianmusicalexpressionhasbeenmorecompositethanusuallyrealized.Isit possible to use the fact to explain the rationale governingthe origin, nature, and function of the paintings? 6. What are the probable reasons which confined the ragamala tradition to a certain part of the country? Were there any musical reasons for it? 7. Meshakama's attempt certainly provides the most complete model of the paintings. But is it possible to ascribe deviations from his work to differences in regionalmusicaltraditions? Inother words,pictorialdeviationsfrom Meshakama may prove to be musical/musicological conformities. 0 Note:I wouldlike to dedicate this pre~ntalion to the late AtdhendukumarOaogopadhyay. beneT knownas D.C Gangaly (l Aug. 1881-9Feb.1974).LikePandit V.N. Bhatkhanck (whom Gangaly respected), Anfhendukumarleftaflourishinglegalpractice todevote bimsett to workin the fieldof musicand arts. His insights into the visual artsand music made himamajorthinker analyzing the composite nature ofIndian art theory and its practice. His book Ragas and Raginis laid a firm foundationforthestudyofthe musicalaspectofragamalapaintings.ThefirstUmitededition ofRagas andRaginisin 1935oorWstedofonlyJ6ropies. TIlt:secondedition saw theUghtofdayin 1947. He dedicated this seminal work to Pandit Bhatkhande. Gangoly wn'tesbriefly but touchingly of how Bhatlhande on his sid .bedshed silent rears when be found that the work wasdedicated to him. Gangoly is thorough, fundamental, comprehensive, and systcfJliJtic. His work is at once an encouragement and a challenge to students of Hindustani music - ADR.

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.