Quantum memory for microwave photons in an inhomogeneously broadened spin ensemble Brian Julsgaard,1,∗ C´ecile Grezes,2 Patrice Bertet,2 and Klaus Mølmer1 1Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C, Denmark. 2Quantronics group, SPEC (CNRS URA 2464), IRAMIS, DSM, CEA-Saclay, 91191 Gif-sur-Yvette, France (Dated: December 11, 2013) Weproposeamulti-modequantummemory protocolabletostorethequantumstateof thefield in a microwave resonator into an ensemble of electronic spins. The stored information is protected againstinhomogeneousbroadeningofthespinensemblebyspin-echotechniquesresultinginmemory 3 timesordersofmagnitudelongerthanpreviouslyachieved. Bycalculating theevolutionofthefirst 1 and second moments of the spin-cavity system variables for realistic experimental parameters, we 0 showthatamemorybasedonNVcenterspinsindiamondcanstoreaqubitencodedonthe|0iand 2 |1i Fock states of thefield with 80% fidelity. n a PACSnumbers: 03.67.Lx,42.50.Ct,42.50.Pq J 8 Ensembles of electronic spins have been proposed as nance, a method known to tolerate an inhomogeneous ] quantum memories in hybrid architectures for quan- microwave field. Stability of the ensemble after inver- h tum computing including superconducting qubits [1–4]. sionis ensuredprovidedthe cavityqualityfactoris suffi- p Progress in this direction was reported in a number of cientlylow[21]. Sincethisisincompatiblewithafaithful - t experiments, demonstrating first strong coupling of an transferofquantuminformationfromthe cavityintothe n a ensemble of spins in a crystal to a superconducting res- spins, we propose to use a cavity with a quality factor u onator [5–11], and more recently reversible storage of a that can be tuned in-between the steps of the protocol, q single microwave photon in the spin ensemble [12, 13]. as was recently demonstrated with SQUIDs [22]. In ad- [ Fromtheseresultsitclearlyappearsthatinhomogeneous dition, inspired by a recent proposal of atomic-ensemble 1 broadening of the spin ensemble is a major obstacle, quantum memories for optical photons [23], we employ v which needs to be overcome for hybrid quantum cir- twoπ pulsesintherefocusingscheme. Toavoidemitting 0 cuits to fully benefit from the long spin-coherence times. amicrowaveechofromtheinvertedspinensemble,which 0 Duetoinhomogeneousbroadening,quantuminformation wouldotherwisebemorenoisythantheoriginalquantum 5 1 leaks from the ”bright”collective degree of freedomcou- state[24],wedetunethecavityfromthespinsin-between . pled to the cavity into dark modes of the spin ensemble thetwopulses(effectively”silencing”thisnoisyfirstecho 1 [14–16]. An appealing possibility is to actively and co- [23]). The second echo, formed in a non-inverted ensem- 0 3 herently restore it using refocusing techniques, inspired ble, restores quantum information with a fidelity up to 1 from magnetic-resonance methods [17] and based on the 80 % for realistic parameters. v: application of π pulses to the spins acting as time re- The proposed physical setup is shown schematically i versal. However,theseideasfaceanumberofchallenges: in Figs. 1(a) and (b); a diamond crystal containing NV X (i)Thespatialinhomogeneityofthemicrowaveresonator centers[18]isplacedontopofatransmission-wave-guide ar fieldmaymakeitdifficulttoapplyaπ pulseefficientlyto cavity whose frequency ωc [22] and coupling to the mea- eachspin,(ii)aftertheπ-pulseinversion,thespinensem- suringlineκ[25]canbetunedonananosecondtimescale bleshouldremainstabledespiteitscouplingtothecavity, using control lines (not shown in Fig. 1). The crystal is and (iii) the whole statistics of the collective spin must subjected to a constant bias magnetic field B , lift- NV be restored at the single quantum level. The present ing the degeneracy of the m = 1 states, and bring- S ± work proposes a protocol, which addresses all these is- ing the 0 1 transition to an average frequency ω = s → sues, and we exemplify its feasibility for the specific case 2π 2.9GHz. In the frame rotating at ω the free evolu- s · of NV centers in diamond [18], using currently available tionofthecavityfieldandthespinensembleisdescribed experimental techniques and realistic parameters. The by the Hamiltonian: Hˆ0 = ∆csaˆ†caˆc+Pj ∆2jσˆz(j), where proposed memory extends the storage times by several aˆ isthecavityfieldannihilationoperator,∆ =ω ω c cs c s orders of magnitude compared to [12, 13]. It is intrin- is the (adjustable) spin-cavity detuning, ∆ = ω −ω , j j s sically multi-mode and thus allows to store reversibly a ω the resonance frequency of the jth spin and σˆ(j−) the j z number of quantum states, paving the way to the real- corresponding Pauli operator. NV centers are coupled ization of a genuine quantum Turing machine [2, 19]. by hyperfine interaction to the nuclear spin of their ni- In our proposal the π pulses are performed by rapid trogen atom (having a spin 1), causing the m = 0 1 S → adiabatic passage [20] through the electron spin reso- transition to split into a triplet separated by ∆ /2π = hfs 2 (a) (b) B [Gs] 1 3 5 7 are known to remedy this issue [32]. The pulses are ap- pliedbyanexternaldriveβ modeledbytheHamiltonian 40 κ gens z Hˆext = i√2κ(βaˆ†c −β∗aˆc). Note that to achieve the de- β 20 sired temporal dependence of aˆ , β must be further tai- c ωc ωs 0 BNV lored in order to account for the cavity filtering and the -40 -20 0 20 40 coupling to the spins [27]. x [µm] WSW The quantum memory protocol, shown schematically ] 3 (c) 1 1] 1.5 (d) in Fig. 2(a), aims to store a cavity-field state given at 1 − −s 2s t = 0 and retrieve it again at t = Tmem with the cavity −8 2 −0 1.0 tuned to a “target frequency” ∆t . This quantum state 0 1 cs ∆)[1 1 Γ ρ(g)[ 0.5 cmoounldqbuebitdealliovnergedthbeyl,inee.sg.,ofa[1s2u]p.erT-choendcauvcittiyngsttartaensis- f( 0-20 -10 0 10 202g2gens0.00 5 10 15 20 25 then transfered to the spins by setting ∆cs = 0 for ∆/2π[MHz] g/2π[Hz] a time Tswap after which the cavity is parked at ∆pcs. In a lowest-order approximation T = π/2g where swap ens FIG. 1. (Color online) (a) Quantum memory circuit. The gens = [R g2ρ(g)dg]1/2 corresponds to the resonator-spin resonator, with frequency ωc and damping rate κ tunable at ensemble swap rate [12, 13, 16], but in reality is opti- the nanosecond scale, is coupled to the spin ensemble (fre- mized numerically. For a high-fidelity storage, we set quency ωs) with an ensemble coupling constant gens. Drive κ = κ = ωc with Q = 104 so that the spin pulses of amplitude β(t) are applied to the spins via the res- min 2Qmax max ensemble and resonator are in strong coupling. Next, in onator, which can be initialized in a well-defined quantum order to refocus the reversible spin dephasing we apply state |αi. (b)Amplitudeof themicrowave field generated by a coplanar resonator with quality factor Q=100 and driven twoπ pulsesat∼Tm4em and∼3Tm4em with∆cs =0,andto by a pulse of 100 µW power. A static magnetic field BNV stabilize the inverted spin ensemble, we set κ = κmax = is applied parallel to the spins, which are distributed uni- ωc with Q = 100 before the π pulses so that the 2Qmin min formly throughoutthecrystal. (c)Sub-ensembledistribution cooperativityparameterfulfillsC = ge2ns <1[21]. Anad- f(∆)ofspin-resonancefrequencies(circles)consistingofthree κΓ hyperfine-split Lorentzian lines. The solid line shows the ex- ditional constraint comes from the fact that tuning the citationprobabilityforthechosensecanthyperbolicinversion cavity frequency or quality factor with SQUIDs is possi- pulses(seetext). (d)(Solidline)Calculatedcoupling-strength bleonlyifthecavityfieldissufficientlylow( aˆ <10), c distribution function ρ(g)g2. (Histogram and circles) Sub- which requires sufficient delay to allow it to|hdecia|y∼after ensemble distribution used in the calculation. The low- and theπpulses. Betweenthetwoπpulses,weset∆ =∆p high-frequency cut-offs in ρ(g) originate from, respectively, cs cs in order to silence the first spin echo [23]. After the sec- high (40µm) and low (0.5µm) cut-offs in the distance from ondπ pulse the quantumstate is retrievedfromthe spin theresonator to NV centers. ensemblebysetting∆ =0duringT afterwhichthe cs swap cavity is tuned to ∆t . cs The numerical calculation of the dynamical evolution 2.2MHz [26]. In addition, they are coupled by dipolar is made tractable by dividing the spins into M sub- interactions to a bath of magnetic dipoles [27], which ensembles along the lines of [21] keeping account of the is known to govern their coherence time [28–30]. This meanvaluesandcovariancesbetweencavity-fieldquadra- bath broadens each of the hyperfine resonances, with a Lorentzian line shape [29] of width w, corresponding to tures, Xˆc andPˆc, and spin components, Sˆx(m), Sˆy(m), and a free-induction-decay time T∗ = 2. A Hahn-echo pulse Sˆ(m)ofthemthsub-ensemble[27]. Sucharepresentation 2 w z sequence [17] partially refocuses this coherence, yielding is convenient for determining the memory performance a coherence time T which can be severalorders of mag- for,e.g.,coherentinputstates. SpecificforourNV-center 2 nitude longer than T∗. In this work, we thus model example we use g =2π 3.5MHz, w =2π 2MHz cor- 2 ens · · the system by the static inhomogeneous spin distribu- responding to T∗ = 0.16µs, T = 100µs [27], and hy- 2 2 tion shown in Fig. 1(c) of characteristic width Γ w perbolic secant π pulses truncated at a duration of 1 µs [27], and damped at a rate γ = T−1 in the Ma≈rkov withµ=3.5andµβ =2π 7.5MHz. We assumethat ⊥ 2 sech · approximation [27]. The spin-cavity interaction is de- a microwave drive of peak power up to 100 µW can be scribed by: HˆI =Pjgj(σˆ+(j)aˆc+σˆ−(j)aˆ†c), where the cou- applied to the sample input without causing too much plingconstantg ofthejthspinisdistributedasshownin heating. j Fig.1(d)[27]. Thisdistributionisofnoconcernforstor- Typicalresults ofour calculationsareshowninFig. 2. ing the quantum state [12]; however, it prevents the ap- Panel (b) shows the mean values of Xˆ and Pˆ when a c c plicationofa”hard”π pulse since eachspin hasa differ- weak coherent cavity-field state is given at t = 0. Even entRabifrequencyforagivendriveamplitude. So-called though the cavity field is very strong during the inver- hyperbolic secant pulses [31], where the pulse amplitude sion pulses at t 2.5µs and t 7.5µs, it relaxes to ≈ ≈ and phase are modulated as a =amax[sech(β t)]1+iµ, negligible levels prior to memory retrieval. Due to an c c sech 3 π π (a) -pulse -pulse spin ensemble as a classical memory. In order to assess Silenced Storage echo Retrieval the quantum properties of the memory we also calcu- late the evolution of variances by the coupled first- and Δt Δp cs cs Δ second-momentequationsdetailedinthe Supplementary 0 cs κ κ Material [27], see Fig. 3. Panel (a) shows the summed 0 min κ max varianceofXˆc andPˆc,whichdeviatesfromthecoherent- statevalueofunityduringinversionpulses. Atthemem- 4·106 (b)a|c110036 oryretrievalthevariancealsoincreaseswhenthecavityis Pc 2 |100 tuned to resonancewith Q=Qmax due to emissionfrom d spins left in the excited state by a non-perfect inversion n a 0 process (in analogy to Ref. [24]), but most importantly Xc ×106 ×106 -2 this excess noise of only 11 % maintains easily the quan- tumnatureofthe memory. Panel(b)showsthe summed 0 2 4 6 8 10 t[µs] varianceof the spincomponents, Sˆeff andSˆeff, whichre- eff()pexc 1 (c) lraextreisevaalml.ost to the coherent-statexvalue atythe memory d n a We stress the indispensable role of the spin-frequency N 0 inhomogeneity, which for a resonant cavity in low-Q / ×105 ×105 ×105 eff⊥ mode gives rise to the effective cooperativity parameter S 0 2 4 t[µs] 6 8 10 C = ge2ns 0.38. Accordingto[21]thisensures(i)that κmaxΓ ≈ the excess variance of Xˆ , Pˆ , Sˆeff, and Sˆeff converge to c c x y FIG. 2. (Color online) (a) Schematic timing of pulses and moderate, finite values during the resonant,inverted pe- cavityparameters,∆cs andκ. Periodsofresonance(∆cs =0) riod (see, e.g., Fig. 3(a,b) at 3µs < t < 4µs), and (ii) are marked by gray areas. (b) Cavity-field mean values, Xc that mean values of the coupled sp∼in-c∼avity system ob- (black) and P (gray) versus time. The inset re-plots the c servablesrelaxsufficiently fastfrompossiblyimperfectπ dashed-lineregionwith|haˆ i|onthelogarithmicverticalscale. c pulses as exemplified in the inset of Fig. 2(b). For the (c) The g-weighted transverse-spin-component mean value Sti⊥eoffnp=ropbaSbxeifflit2y+peSxyecff(2gr(abyl,adckas)hnedorcmuarlviez)e,dantodNth,etgh-weeeixgchittead- ospffi-nrecsoomnapnotnecnatvsitayrethdeamfirpsetdaonndtsheecTon2∗dtimmoemsceanltesaosfsethene excitation probability peff (gray,solid curve). in Fig. 2(c) prior to the primary echo and in Fig. 3(b) exc at t 4µs, respectively. This is essential for the perfor- ≈ mance of the protocol; any reminiscence of the inversion pulses andexcessnoise inthe spin ensemblemustvanish imperfect storage process [marked by the arrow in panel both at the time of the primary echo andof the memory (b)] a minor part of the field is left in the cavity (14 retrieval. % in field strength or 2 % in energy units), but most Toassesstheperformanceofthequantummemory,we importantly aˆ recovers at t = T a value compa- c mem |h i| repeat the above simulation with various other coherent rable to the one at t = 0. Regarding the spin state, input states. A selection of these are shown in Fig. 3(c) we consider the effective, g-weighted spin observables, Sˆηeff = Pj gg¯jσˆη(j), η = x,y and g¯ = gens/√N, which icnirctleersm)sasocformetpraierveeddtomtehaonsevaolfuethseanindpuvtarsitaantceess(b(glaracky couple directlyto the cavityfield aˆ throughthe interac- c tion Hamiltonian Hˆ . Panel (c) shows the magnitude of circles). Weconfirmthattheinput/outputrelationscon- I stitutealinearmap,which(i)essentiallymapsvacuumto these transverse spin components; in the storage part it vacuum (with a slightly increased variance) demonstrat- grows as the quantum state is swapped from the cav- ingthattheremainsoftheinversionpulsesarenegligible ity and then decays within T∗ due to inhomogeneous 2 and (ii) which presents a gain factor = 0.79 for the broadening. Despite the excitation of very large mean G mean values. The quadrature variances of the retrieved spincomponentsby theπ pulses,the muchweakermean states amount to 2σ2 = δXˆ2 + δPˆ2 =1.11.Since any values of the stored spin states are recovered as a pri- h ci h ci quantum state can be expressed as a superposition of mary echo [arrow in panel (c)] and at the final memory coherentstatesthememoryshouldworkforarbitraryin- retrieval. Panel (c) also shows the excitation probabil- put states, e.g. Schr¨odinger cats [33], and qubit states ity p = Sz+N and the effective, g-weighted excitation exc 2N encoded in the 0 and 1 Fock states of the cavity. The probability peeffxc = 21N(Pj gg¯j22σˆz(j)+N) versus time. The storage time de|peinds o|nithe quantum state and the de- latter reaches 89 % between inversion pulses and levels sired fidelity. Following [34] we obtain a qubit fidelity off at 8 % after the second inversion pulse. F =80 % for T =10µs. q mem The above results can be extracted from mean-value To investigate the implications of the limited peak equations alone and demonstrate the feasibility of the poweravailableforinversionpulses,theabove-mentioned 4 i1.2 (a) 3 ˆ2Pc δ 2 i+h1.1 a|c 1 ×10−6 ×10−6 2c | ˆδX1.0 0 h 0 2 4 6 8 10 0 2 4 6 8 10 12 t[µs] Time[µs] N 2 / (b) 2i) 2 FIG. 4. (Color online) The cavity field |ac| versus time in ff ˆeSy a multi-mode storage example with four input fields (|ac| = hδ 1 3,0,1,2)separatedby0.29µs,withmemorytime12µs. The + amplitude-cross-talk is below 3 %. i ˆeff2Sx 00 2 4 t[µs] 6 8 10 δ (h which in terms of gain can be written approximately as: (c) 1.1 (d) = exp( κ[ π +2T ])exp( γ [T 0.7µs]). ˆoutPc 46 2,2σ 1.0 TGheGκ0-depen−den2tgefnasctor ychieirlpds ≈ 0.−92⊥duemteom−cavity de- nd- 2 effpexc 0.9 cinaiytidalurainndgtfihnearlefsroenqaunetncsywacphpiripngopfrdoucreastsioanndTdurin.gTthhee ˆinPac 0 0 2 4 6 G,F,q 00..7810 20 50 100200500 eγn⊥c-ede(ppeanrtdleynstufpapcrtoesrseydielwdhse≈n t0h.9e1qudaunettuomspstinacthedireprceoshideers- Xˆcin and-Xˆcout Ppeak [µW] in the cavity or a population degree of freedom). The main contribution to excess noise arises from imperfect FIG. 3. (Color online) (a) Summed variance of cavity-field inversion processes, e.g. due to the dephasing rate γ ⊥ quadratures. (b) The summed, g-weighted spin-component during π pulses. In the limit T ,Q the qubit 2 max variance normalized to 2N. (c) Various input states (black) → ∞ fidelity becomes 97%, and the originof the remaining and output states (gray, sign reversed) examined in the pro- ≈ infidelity ( 0.97 and 2σ2 1.01) includes a non- tocol. The center of circles mark mean values whereas the 0 G ≈ ≈ radii mark the standard deviation σ of the state. (d) Open perfect cavity-to-spin transfer (arrow in Fig. 2(b)) and symbols: The dependence of gain G (blue triangles), qubit residual imperfections in the inversion processes. fidelity Fq (magenta circles), effective excitation probabil- As demonstrated experimentally for classical pulses ity peeffxc (red squares), and summed variance 2σ2 (green di- [35], the spin-ensemble quantum memory is multi-mode amonds)onthepeakpowerP oftheexternaldrivingfield peak in nature, which we confirm by simulating storage and during inversion pulses. Closed symbols: Simulations with retrieval of four pulses, see Fig. 4. The number of stor- P =100µW and homogeneous coupling g=2π·12.5 Hz, lepaedaikng toG =0.82, 2σ2 =1.02, and Fq =87%. agemodes(proportionaltoT2∗/T2)thatcanbefaithfully addressed and refocused is estimated to be 100 [27]. ∼ In summary, a multi-mode spin-ensemble-based quan- tum memory for cavity fields has been proposedand an- analysisisrepeatedforaselectionofpeakpowersranging alyzed for a specific realization using NV centers in di- from20µWto500µWleadingtotheresultspresentedin amond. With realistic experimental parameters a qubit Fig. 3(d) with open symbols. Furthermore, a simulation fidelity of F =80% is predicted for T =10µs. The iscarriedoutatP =100µWbutwithahomogeneous q mem peak main limiting processes are clarified, and we predict a distribution of coupling strengths, g/2π=12.5 Hz (solid qubit fidelity F > 2, better than achieved by any clas- symbols in Fig. 3(d)). Clearly, increasing Ppeak presents sical strategy, fqor m3emory times of T < 69µs. The an increase in due to a better inversion process, but mem G memorytime maybe furtherincreasedby d∼ynamicalde- since in an intermediate regime a fraction of spins expe- couplingtechniques[36,37]orquantum-statetransferto riences a poor inversion process due to insufficient Rabi nuclear-magnetic degrees of freedom [38]. frequency (limiting the inversionperformanceillustrated The authors acknowledge useful discussions with by the dashed curve in Fig. 2(c)) we observe the non- monotonous behavior of 2σ2 shown in Fig. 3(d). While T. Chaneli`ere, D. Esteve, and Y. Kubo and support from the EU integrated project AQUTE, the EU 7th increasing driving powers may be infeasible from an ex- Framework Programme collaborative project iQIT, and perimentalpointofviewanalternativeroutetoimprove- the ANR project QINVC (CHIST-ERA program). mentliesintailoringamorehomogeneousdistributionof coupling strengths, e.g.by limiting the distance between NV centers and the cavity. Continuingtheanalysiswithahomogeneouscoupling- strength distribution (solid symbols in Fig. 3(d), Fq = ∗ [email protected] 87%),wefindthelimitingfactorsfortheobtainedfidelity, [1] A. Imamoglu, Phys.Rev.Lett. 102, 083602 (2009). 5 [2] J. H. Wesenberg, A. Ardavan, G. A. D. Briggs, J. J. L. J. Wrachtrup, and C. von Borczyskowski, Morton,R.J.Schoelkopf,D.I.Schuster, andK.Mølmer, Science 276, 2012 (1997). Phys.Rev.Lett. 103, 070502 (2009). [19] K. Tordrup, A. Negretti, and K. Mølmer, [3] D. Marcos, M. Wubs, J. M. Taylor, Phys. Rev.Lett. 101, 040501 (2008). R. Aguado, M. D. Lukin, and A. S. Sørensen, [20] A. Abragam, The principles of nuclear magnetism Phys.Rev.Lett. 105, 210501 (2010). (Clarendon Press, Oxford,1961). [4] W. L. Yang, Z. Q. Yin, Y. Hu, M. Feng, and J. F. Du, [21] B. Julsgaard and K. Mølmer, Phys.Rev.A 84, 010301R (2011). Phys. Rev.A 86, 063810 (2012). [5] Y. Kubo, F. R. Ong, P. Bertet, D. Vion, V. Jacques, [22] A. Palacios-Laloy, F. Nguyen, F. Mal- D.Zheng,A.Dreau,J.F.Roch,A.Auffeves,F.Jelezko, let, P. Bertet, D. Vion, and D. Esteve, J.Wrachtrup,M.F.Barthe,P.Bergonzo, andD.Esteve, J. Low Temp. Phys. 151, 1034 (2008). Phys.Rev.Lett. 105, 140502 (2010). [23] V. Damon, M. Bonarota, A. Louchet- [6] D. I. Schuster, A. P. Sears, E. Ginossar, L. DiCarlo, Chauvet, T. Chaneli`ere, and J.-L. Le Gou¨et, L. Frunzio, J. J. L. Morton, H. Wu, G. A. D. Briggs, New J. Phys.13, 093031 (2011). B. B. Buckley, D.D. Awschalom, and R.J. Schoelkopf, [24] J. Ruggiero, J.-L. Le Gou¨et, C. Simon, and Phys.Rev.Lett. 105, 140501 (2010). T. Chaneli`ere, Phys. Rev.A 79, 053851 (2009). [7] R. Amsu¨ss, C. Koller, T. N¨obauer, S. Putz, S. Rotter, [25] Y. Yin, Y. Chen, D. Sank, P. J. J. O’Malley, T. C. K. Sandner, S. Schneider, M. Schramb¨ock, G. Stein- White, R. Barends, J. Kelly, E. Lucero, M. Mariantoni, hauser, H. Ritsch, J. Schmiedmayer, and J. Majer, A. Megrant, C. Neill, A. Vainsencher, J. Wenner, Phys.Rev.Lett. 107, 060502 (2011). A. N. Korotkov, A. N. Cleland, and J. M. Martinis, [8] M. U. Staudt, I.-C. Hoi, P. Krantz, M. Sandberg, arXiv:1208.2950. M.Simoen, P.Bushev,N.Sangouard,M. Afzelius, V.S. [26] S. Felton, A. M. Edmonds, M. E. Newton, P. M. Mar- Shumeiko,G.Johansson, P.Delsing, andC.M.Wilson, tineau, D. Fisher, D. J. Twitchen, and J. M. Baker, J. Phys. B: At.Mol. Opt.Phys. 45, 124019 (2012). Phys. Rev.B 79, 075203 (2009). [9] H. Huebl, C. Zollitsch, J. Lotze, F. Hocke, M. Greifen- [27] “See supplementary material for details.”. stein, A. Marx, R. Gross, and S. T. B. Goennenwein, [28] R. Hanson,V. V.Dobrovitski, A.E. Feiguin, O.Gywat, arXiv:1207.6039. and D.D. Awschalom, Science 320, 352 (2008). [10] V. Ranjan, G. de Lange, R. Schutjens, T. Debelhoir, [29] V.V.Dobrovitski,A.E.Feiguin,D.D.Awschalom, and J. P.Groen, D.Szombati, D. J. Thoen, T. M. Klapwijk, R. Hanson, Phys.Rev. B 77, 245212 (2008). R.Hanson, and L. DiCarlo, arXiv:1208.5473. [30] N. Zhao, S.-W. Ho, and R.-B. Liu, [11] S.Probst, H.Rotzinger, S. Wu¨nsch, P. Jung, M. Jerger, Phys. Rev.B 85, 115303 (2012). M. Siegel, A. V. Ustinov, and P. A. Bushev, [31] M. S. Silver, R. I. Joseph, and D. I. Hoult, arXiv:1212.2856. Phys. Rev.A 31, R2753 (1985). [12] Y. Kubo, C. Grezes, A. Dewes, T. Umeda, J. Isoya, [32] M. Garwood and L. DelaBarre, H. Sumiya, N. Morishita, H. Abe, S. Onoda, J. Mag. Res. 153, 155 (2001). T. Ohshima, V. Jacques, A. Dr´eau, J.-F. Roch, I. Di- [33] H. Wang, M. Hofheinz, M. Ansmann, R. C. Bialczak, niz, A. Auffeves, D. Vion, D. Esteve, and P. Bertet, E.Lucero,M.Neeley,A.D.OConnell,D.Sank,M.Wei- Phys.Rev.Lett. 107, 220501 (2011). des, J. Wenner, A. N. Cleland, and J. M. Martinis, [13] X. Zhu, S. Saito, A. Kemp, K. Kakuyanagi, S.-i. Kari- Phys. Rev.Lett. 103, 200404 (2009). moto,H.Nakano,W.J.Munro,Y.Tokura,M.S.Everitt, [34] J. F. Sherson, H. Krauter, R. K. Olsson, B. Juls- K. Nemoto, M. Kasu, N. Mizuochi, and K. Semba, gaard, K. Hammerer, I. Cirac, and E. S. Polzik, Nature478, 221 (2011). Nature 443, 557 (2006). [14] Z. Kurucz, J. H. Wesenberg, and K. Mølmer, [35] H. Wu, R. E. George, J. H. Wesenberg, K. Mølmer, Phys.Rev.A 83, 053852 (2011). D. I. Schuster, R. J. Schoelkopf, K. M. Itoh, A. Ar- [15] I.Diniz,S.Portolan,R.Ferreira,J.M.G´erard,P.Bertet, davan, J. J. L. Morton, and G. A. D. Briggs, and A. Auff`eves,Phys. Rev.A 84, 063810 (2011). Phys. Rev.Lett. 105, 140503 (2010). [16] Y.Kubo,I.Diniz,A.Dewes,V.Jacques,A.Dr´eau,J.-F. [36] G. de Lange, Z. H. Wang, D. Rist`e, V. V. Dobrovitski, Roch, A. Auffeves, D. Vion, D. Esteve, and P. Bertet, and R.Hanson, Science 330, 60 (2010). Phys.Rev.A 85, 012333 (2012). [37] N. Bar-Gill, L. M. Pham, A. Jarmola, D. Budker, and [17] E. L. Hahn,Phys. Rev.80, 580 (1950). R. L. Walsworth, arXiv:1211.7094. [18] A. Gruber, A. Dr¨abenstedt, C. Tietz, L. Fleury, [38] G. D. Fuchs, G. Burkard, P. V. Klimov, and D. D. Awschalom, NaturePhys.7, 789 (2011). SUPPLEMENTARY MATERIAL The effective spin-1 Hamiltonian 2 The interaction Hamiltonian between the spin state of NV centers and the microwave cavity field is calculated in the following. The electronic part of the Hamiltonian for a single NV-center in an external magnetic field reads: 3 1 0 Hˆ = DSˆz2 +E(Sˆx2 −Sˆy2)+gNVµBSˆ ·Bˆ, (1) 2 n where D = 2π 2.88GHz is the zero-field splitting between the m = 0 and m = 1 states, a · S S ± J 8 E is a splitting between the mS = ±1 states induced by non-axial strain [1], gNV = 2 is the gyro-magnetic ratio, µ is the Bohr magneton, Sˆ is the real spin (not to be confused with ] B h p the collective ensemble-spin Sˆ defined elsewhere in the manuscript), and Bˆ is the external - t magnetic field. The NV-center axis defines the direction of quantization along z, which we n a u assume in this work to be parallel to the sample. q [ The NV center is effectively reduced to a two-level system by applying a static bias 1 magnetic field B . If the Zeeman energy verifies g µ B E, which is the case for v z NV B z ≫ 0 B 0.5mT, the spin states m = 0, 1 are also energy eigen states. Taking as our ground 0 ≥ S ± 5 state g = m = 0 and excited state e = m = 1 , the transition energy becomes: 1 | i | S i | i | S i . 1 ω = D + g µ B + O E2 . As will be detailed below, the quantized cavity field is 0 NV B z gNVµBBz 3 linearly polarized within(cid:16)the xy-p(cid:17)lane and can be written: Bˆ = δB(aˆ +aˆ ). In perturbation 1 c †c : v theory the interaction part of the Hamiltonian then reads: i X Hˆ = g µ ˆ δB (r)+ ˆ δB (r) (aˆ +aˆ ) r I NV B Sx x Sy y c †c a g µ h i = NV B ˆ δB (r) iδB (r) + ˆ δB (r)+iδB (r) (aˆ +aˆ ) 2 S+{ x − y } S−{ x y } c †c g µ h i (2) = NV B aˆ σˆ δB (r) iδB (r) +aˆ σˆ δB (r)+iδB (r) √2 c +{ x − y } †c −{ x y } g µ (cid:2)δB (r) (cid:3) NV B → √| 2 ⊥ | aˆcσˆ+ +aˆ†cσˆ− . (cid:2) (cid:3) Thesecondlineusesthestandarddefinitionofraising-andloweringoperators, ˆ = ˆ iˆ , x y S± S ± S with properties: ˆ m = ( +1) m (m 1) m 1 . Restricted to our effective S±| Si S S − S S ± | S ± i two-level system, g and ep, these operators can be stated in terms of Pauli operators: | i | i ˆ = √2σˆ , which has been exploited in the third line together with the rotating-wave S± ± approximation. The last expression is obtained by writing δB (r)+iδB (r) = δB (r) eiθ(r) x y | ⊥ | 1 and re-defining our basis states as g and e iθ(r) e (such that the phase factor is absorbed − | i | i into σˆ ). We conclude that the coupling between the cavity field and the effective spin-1 of 2 ± the jth NV center located at r is given by: j g µ δB (r ) NV B j gj = | ⊥ |. (3) √2 Analytical expressions for the magnetic field of a wave traveling in the z direction along a coplanar transmission line of the geometry, shown in Fig. 1(b) of the main text, can be expressed as a function of the voltage V between the center conductor and the ground 0 plane [2]: ¯ 2µ V ∞ 1 sinnπδ/2 nπδ nπx B = 0 0√ǫ sin cos e γny, x eff − − ηb F nπδ/2 2 b n=1 n (cid:20) (cid:21) X ¯ 2µ V ∞ sinnπδ/2 nπδ nπx By = 0 0√ǫeff sin sin e−γny, (4) − ηb nπδ/2 2 b n=1(cid:20) (cid:21) X 2 nπ 2 4πcb√ǫ 1 eff γ = + − . n s b nω (cid:18) c (cid:19) (cid:16) (cid:17) In this expression, µ is the vacuum permeability, η = 376.7 the vacuum impedance, c the 0 speed of light, ǫ = (ǫ + 1)/2, ǫ being the relative dielectric constant of the substrate, eff r r and δ = W/b, δ¯= (S +W)/b, F = bγn are geometrical quantities with S the width of the n nπ coplanar waveguide central conductor, W its distance to each ground plane [see Fig. 1(b) of the main text], and b the ground plane width. In a λ/2 coplanar waveguide resonator of length L defined by a transmission line open at z = 0 and z = L, the fields are generated by voltages and currents V(z) = V(0)cos(πz/L) and I(z) = iV(0)sin(πz/L)/Z , so that the current in the middle of the transmission 0 − line verifies I(L/2) = iV(L)/Z , the same relation as between the current and voltage of 0 a traveling microwave at a given position of a coplanar waveguide. The zero-point rms fluctuations of the magnetic field in the middle of the resonator are thus directly obtained by replacing in the previous expressions V by the zero-point rms fluctuations of the voltage 0 at the resonator end δV (L) = ω h¯Z /π [3]. In this work we chose the waveguide geometry 0 c 0 so that Z = 50Ω, as was the caspe in a number of recent experiments [4]. 0 Using the expression for the rms zero-point magnetic field fluctuations, we obtain the dependence of the coupling constant of a spin located in the middle of the resonator (z = L/2) as a function of x,y. From that we calculate the coupling constant distribution shown in Fig. 1(d) of the main text. 2 The electron-spin-resonance transition of the NV ensemble We now discuss the spin lineshape and coherence properties that were chosen in the main text. The electronic spin of all NV centers is also coupled by hyperfine interaction to the nuclear spin of the nitrogen atom. This leads to an additional structure of the electron spin resonance. In the case of NV centers with a 14N nucleus as is the case with diamond samples prepared with natural nitrogen abundance, the spectrum is known to consist of three peaks separated by ∆ /2π = 2.2MHz [5]. hfs In addition to the hyperfine coupling to the nitrogen nucleus, NV centers are coupled to a bath of other spins that determines their coherence properties, namely the line width and the spin echo time T . Two different well-identified spin baths contribute to NV center de- 2 coherence: nitrogen impurities (so-called P1 centers), and 13C nuclear spins. Hybrid circuit experiments usually require a rather high concentration in NV centers (typically 1ppm or more), in order to efficiently absorb single photons or equivalently to reach the strong cou- pling regime. This high concentration also implies a comparatively large concentration of P1 centers (on the order of a few ppm), which at this level are mostly responsible for the sample coherence properties [6]. A sample with [NV] 2ppm and [P1] 2ppm can be achieved ∼ ∼ with usual crystal preparation techniques (electron irradiation of a nitrogen-doped crys- tal). According to [6], such a sample would have a line width of each of the hyperfine peaks around w/2π = 0.5MHz, a spin-echo coherence time T 100µs, and according to [7] would 2 ∼ be coupled to a coplanar resonator with an ensemble coupling constant g /2π 3MHz. ens ∼ These are parameters similar to the ones we use in our calculations (see main text), apart for the line width which we take somewhat broader w/2π = 2MHz. Broadening the line width purposely could easily be achieved, either by adding a slightly inhomogeneous mag- netic field, or by a slight misalignment of the magnetic field with a crystalline axis, which results in a slight difference in Zeeman shift for NV centers with different orientation [7]. We finally note that in order to avoid complications of Electron Spin Echo Envelope Modulation (ESEEM) caused by the interaction with the bath of 13C nuclei [8], it would be preferable to use a 12C-isotope-enriched diamond crystal for this experiment. With a sample having natural abundance of 13C, our refocusing protocol would still work, but only for discrete times corresponding to the spin-echo revivals depending on the applied magnetic field, and for NV centers having their axis well aligned with the magnetic field [8, 9]. All effects taken 3 together, the spin distribution can be expressed as w 1 1 1 f(∆) = + + , (5) 6π "(∆−∆hfs)2 + w42 ∆2 + w42 (∆+∆hfs)2 + w42# The corresponding characteristic width [10] can be derived: w (γ + w)2 +∆2 Γ = γ + ⊥ 2 hfs . (6) ⊥ 2 (γ + w)2 + 1∆2 2 3 hfs (cid:16) (cid:17) ⊥ We note that the free induction decay of an ensemble of identically prepared spins, (j) σˆ (0) σˆ (0) , can be expressed as: h − i ≡ h − i N Sˆ (t) = σˆ(j)(0) e−(γ⊥+i∆j)t = N σˆ (0) ∞ f(∆)e−(γ⊥+i∆)td∆ h − i h − i h − i Xj=1 Z−∞ (7) 1 = Sˆ (0) [1+2cos(∆hfst)]e−(γ⊥+w2)t. 3h − i As stated in the main text, the time scale for free induction decay, T = 2 (taking γ w), 2∗ w ⊥ ≪ is seen to characterize the envelope function of the modulated decay, caused by the hyperfine splitting. EQUATIONS OF MOTION FOR FIRST AND SECOND MOMENTS USING SUB- ENSEMBLES With the considerations of the above section, a Hamiltonian for the physical system can be written in the frame rotating at the central spin frequency, ω as: s N N h¯ Hˆ = h¯∆ aˆ aˆ + ∆ σˆ(j) +ih¯√2κ(βaˆ β aˆ )+h¯ g (σˆ(j)aˆ +σˆ(j)aˆ ), (8) cs †c c 2 j z †c − ∗ c j + c − †c j=1 j=1 X X where ∆ = ω ω is the detuning of the cavity-resonance frequency ω from ω , and cs c s c s − ∆ = ω ω with ω being the individual spin-resonance frequencies. The sums add the j j s j − contribution from the N spins residing in the volume considered. An external coherent-state field, β, may be used to drive the cavity field aˆ through a coupling capacitor, which gives c rise to the cavity-field-decay rate κ. The c-number β is normalized such that β 2 is the | | incoming number of photons per second. Decaymechanisms aretreatedintheMarkovianapproximation. Inourprevious work[10] we employed the formalism of quantum Langevin equations, which has pedagogical appeal 4 for understanding the structure of Eq. (15) below. However, the present work describes more general states of the spin ensemble, in which case we prefer the approach of the Lindblad master equation. This reads: ∂∂ρtˆ = i1¯h[Hˆ,ρˆ]+ kD[cˆk]ρˆwith D[cˆk]ρˆ= −12cˆ†kcˆkρˆ− 12ρˆcˆ†kcˆk +cˆkρˆcˆ†k, where cˆ1 = √2κaˆc accounts for the cavPity leakage. In addition, for the jth (j) spin a population decay with rate γ is modeled by cˆ2,j = √γ σˆ and phase decay with k k − characteristic time τ by cˆ = 1 σˆ(j). Even though γ = 0 in the main text, it is included 3,j √2τ z k here for generality. Our aim is to describe both the storage of weak cavity fields in the spin ensemble and the impact of very strong driving fields needed for spin-refocusing schemes. To this end we develop a formalism, which is applicable for any saturation level of the spins and which accounts for the first and second moments of relevant physical operators [Eq. (9)]. The inhomogeneous spin ensemble is divided into M sub-ensembles, , ,..., , which 1 2 M M M M can each be regarded as homogeneous with coupling strength g , spin resonance frequency m ∆ , and containing N spins for m = 1,...,M. m m Next, the dynamical variables are described in terms of the real-valued operators: aˆ +aˆ Xˆ = c †c, c √2 i(aˆ aˆ ) Pˆ = − c − †c , c √2 Sˆ(m) = (σˆ(j) +σˆ(j)), x + (9) − XMm Sˆ(m) = i (σˆ(j) σˆ(j)), y − + − − XMm Sˆ(m) = σˆ(j). z z XMm The Xˆ and Pˆ operators describe the quadratures of the cavity field with [Xˆ ,Pˆ ] = i, c c c c while the Sˆ(m) components correspond to twice the total spin in each sub-ensemble with k [Sˆ(m),Sˆ(m)] = 2iǫ Sˆ(m). These operators are now linearized around their mean values: j k jkl l Xˆ = X +δXˆ , Pˆ = P +δPˆ , and Sˆ(m) = S(m) +δSˆ(m) for k = x,y,z, i.e. by definition, c c c c c c k k k δXˆ = 0, etc. Using the master equation, the following mean-value equations can then be c h i 5