Multi-Agent Context Management in Support of Ambient Intelligence Applications

208 Pages·2017·5.8 MB·English

by  Alexandru Sorici

Multi-Agent Context Management in Support of
Ambient Intelligence Applications
Alexandru Sorici
To cite this version:
Alexandru Sorici. Multi-Agent Context Management in Support of Ambient Intelligence Applica-
tions. Other [cs.OH]. Ecole Nationale Supérieure des Mines de Saint-Etienne, 2015. English. ￿NNT:
2015EMSE0790￿. ￿tel-01258912￿
HAL Id: tel-01258912
https://theses.hal.science/tel-01258912
Submitted on 19 Jan 2016
HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est
archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents
entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non,
lished or not. The documents may come from émanant des établissements d’enseignement et de
teaching and research institutions in France or recherche français ou étrangers, des laboratoires
abroad, or from public or private research centers. publics ou privés.
NNT: 2015 EMSE 0790
THÈSE
présentée par
Alexandru SORICI
pour obtenir le grade de
Docteur de l’École Nationale Supérieure des Mines de Saint-Étienne
en cotutelle avec Université Politehnica de Bucarest
Spécialité : Informatique
UN INTERGICIEL DE GESTION DU CONTEXTE BASÉ MULTI-AGENT
POUR LES APPLICATIONS D'INTELLIGENCE AMBIANTE
soutenue à Bucarest, le 11 septembre 2015
Membres du jury
Président : Costin BADICA Professeur. Université Politehnica, Bucarest
Rapporteurs : Amal El-Fallah Professeur, Université Pierre et Marie Curie,
SEGHROUCHNI Paris
Michel OCCELLO Professeur, Université Pierre Mendès-
France, Grenoble
Examinateur(s) : Stefan TRAUSAN-MATU Professeur, Université Politehnica, Bucarest
Directeur(s) de thèse : Adina Magda FLOREA Professeur, Université Politehnica, Bucarest
Olivier BOISSIER Professeur, École Nationale Supérieure des
Mines, Saint-Etienne
Gauthier PICARD Maitre de conférence, Ecole Nationale
Supériere des Mines, Saint-Etienne
Spécialités doctorales Responsables : Spécialités doctorales Responsables

SCIENCES ET GENIE DES MATERIAUX K. Wolski Directeur de recherche MATHEMATIQUES APPLIQUEES O. Roustant, Maître-assistant
MECANIQUE ET INGENIERIE S. Drapier, professeur INFORMATIQUE O. Boissier, Professeur
GENIE DES PROCEDES F. Gruy, Maître de recherche IMAGE, VISION, SIGNAL JC. Pinoli, Professeur
SCIENCES DE LA TERRE B. Guy, Directeur de recherche GENIE INDUSTRIEL A. Dolgui, Professeur
SCIENCES ET GENIE DE L’ENVIRONNEMENT D. Graillot, Directeur de recherche MICROELECTRONIQUE S. Dauzere Peres, Professeur
EMSE : Enseignants-chercheurs et chercheurs autorisés à diriger des thèses de doctorat (titulaires d’un doctorat d’État ou d’une HDR)
ABSI Nabil CR Génie industriel CMP
AVRIL Stéphane PR2 Mécanique et ingénierie CIS
BALBO Flavien PR2 Informatique FAYOL
BASSEREAU Jean-François PR Sciences et génie des matériaux SMS
BATTON-HUBERT Mireille PR2 Sciences et génie de l'environnement FAYOL
BERGER DOUCE Sandrine PR2 Sciences de gestion FAYOL
BERNACHE-ASSOLLANT Didier PR0 Génie des Procédés CIS
BIGOT Jean Pierre MR(DR2) Génie des Procédés SPIN
BILAL Essaid DR Sciences de la Terre SPIN
BLAYAC Sylvain MA(MDC) Microélectronique CMP
BOISSIER Olivier PR1 Informatique FAYOL
BORBELY Andras MR(DR2) Sciences et génie des matériaux SMS
BOUCHER Xavier PR2 Génie Industriel FAYOL
BRODHAG Christian DR Sciences et génie de l'environnement FAYOL
BRUCHON Julien MA(MDC) Mécanique et ingénierie SMS
BURLAT Patrick PR1 Génie Industriel FAYOL
COURNIL Michel PR0 Génie des Procédés DIR
DARRIEULAT Michel IGM Sciences et génie des matériaux SMS
DAUZERE-PERES Stéphane PR1 Génie Industriel CMP
DEBAYLE Johan CR Image Vision Signal CIS
DELAFOSSE David PR0 Sciences et génie des matériaux SMS
DESRAYAUD Christophe PR1 Mécanique et ingénierie SMS
DOLGUI Alexandre PR0 Génie Industriel FAYOL
DRAPIER Sylvain PR1 Mécanique et ingénierie SMS
FEILLET Dominique PR1 Génie Industriel CMP
FEVOTTE Gilles PR1 Génie des Procédés SPIN
FRACZKIEWICZ Anna DR Sciences et génie des matériaux SMS
GARCIA Daniel MR(DR2) Génie des Procédés SPIN
GERINGER Jean MA(MDC) Sciences et génie des matériaux CIS
GOEURIOT Dominique DR Sciences et génie des matériaux SMS
GRAILLOT Didier DR Sciences et génie de l'environnement SPIN
GROSSEAU Philippe DR Génie des Procédés SPIN
GRUY Frédéric PR1 Génie des Procédés SPIN
GUY Bernard DR Sciences de la Terre SPIN
HAN Woo-Suck MR Mécanique et ingénierie SMS
HERRI Jean Michel PR1 Génie des Procédés SPIN
KERMOUCHE Guillaume PR2 Mécanique et Ingénierie SMS
KLOCKER Helmut DR Sciences et génie des matériaux SMS
LAFOREST Valérie MR(DR2) Sciences et génie de l'environnement FAYOL
LERICHE Rodolphe CR Mécanique et ingénierie FAYOL
LI Jean-Michel Microélectronique CMP
MALLIARAS Georges PR1 Microélectronique CMP
MAURINE Philippe CMP
MOLIMARD Jérôme PR2 Mécanique et ingénierie CIS
MONTHEILLET Frank DR Sciences et génie des matériaux SMS
MOUTTE Jacques CR Génie des Procédés SPIN
NEUBERT Gilles FAYOL
NIKOLOVSKI Jean-Pierre Ingénieur de recherche CMP
NORTIER Patrice PR1 SPIN
PIJOLAT Christophe PR0 Génie des Procédés SPIN
PIJOLAT Michèle PR1 Génie des Procédés SPIN
PINOLI Jean Charles PR0 Image Vision Signal CIS
POURCHEZ Jérémy MR Génie des Procédés CIS
ROBISSON Bruno Ingénieur de recherche CMP
ROUSSY Agnès MA(MDC) Génie industriel CMP
ROUSTANT Olivier MA(MDC) Mathématiques appliquées FAYOL
ROUX Christian PR Image Vision Signal CIS
STOLARZ Jacques CR Sciences et génie des matériaux SMS
TRIA Assia Ingénieur de recherche Microélectronique CMP
VALDIVIESO François PR2 Sciences et génie des matériaux SMS
VIRICELLE Jean Paul DR Génie des Procédés SPIN
WOLSKI Krzystof DR Sciences et génie des matériaux SMS
XIE Xiaolan PR1 Génie industriel CIS
YUGMA Gallian CR Génie industriel CMP
ENISE : Enseignants-chercheurs et chercheurs autorisés à diriger des thèses de doctorat (titulaires d’un doctorat d’État ou d’une HDR)
BERGHEAU Jean-Michel PU Mécanique et Ingénierie ENISE
BERTRAND Philippe MCF Génie des procédés ENISE
4 DUBUJET Philippe PU Mécanique et Ingénierie ENISE
1
0 FEULVARCH Eric MCF Mécanique et Ingénierie ENISE
2
/0 FORTUNIER Roland PR Sciences et Génie des matériaux ENISE
1
/ GUSSAROV Andrey Enseignant contractuel Génie des procédés ENISE
8
2 : ru LYHOANMNDEIT PHatérdicik MPCUF MMééccaanniiqquuee eett IInnggéénniieerriiee EENNIISSEE
o
j à RECH Joël PU Mécanique et Ingénierie ENISE
e SMUROV Igor PU Mécanique et Ingénierie ENISE
s
iM TOSCANO Rosario PU Mécanique et Ingénierie ENISE
ZAHOUANI Hassan PU Mécanique et Ingénierie ENISE
iii
FONDUL SOCIAL EUROPEAN
Investeşte în oameni!
Programul Operaţional Sectorial pentru Dezvoltarea Resurselor Umane 2007 – 2013. Proiect POSDRU/159/1.5/S/134398
Dezvoltarea resurselor umane din cercetarea doctorala si postdoctorala: motor al societatii bazata pe cunoastere -KNOWLEDGE
UNIVERSITATEA POLITEHNICA DIN BUCUREŞTI
Facultatea de Automatică și Calculatoare
Departamenul de Calculatoare

ECOLE NATIONALE SUPERIEURE DES MINES DE SAINT-ETIENNE
Ecole Doctorale ED-SIS de Saint-Etienne
Laboratoire Hubert Curien, Institut Henri Fayol, Mines Saint-Etienne
Nr. Decizie Senat 236 din 21/07/2015
TEZĂ DE DOCTORAT
Sistem de Gestiune a Contextului bazat pe Sisteme Multi-Agent
în Folosul Aplicațiilor de Inteligență Ambientală
Multi-Agent Based Context Management Middleware
In Support of Ambient Intelligence Application
Autor: Ing. Alexandru SORICI
COMISIA DE DOCTORAT
Universitatea Politehnica
Preşedinte Prof. dr. Theodor BORANGIU de la
București
Universitatea Politehnica
Conducător de doctorat-1 Prof. dr. Adina Magda FLOREA de la
București
Ecole Naționale Superieure
Conducător de doctorat-2 Prof. dr. Olivier BOSSIER de la
des Mines de Saint-Etienne
Ecole Naționale Superieure
Co-supervizor de doctorat As. Prof. dr. Gauthier PICARD de la
des Mines de Saint-Etienne
Referent Prof. dr. Costin BĂDICĂ de la Universitatea din Craiova
Universitatea Politehnica
Referent Prof. dr. Stefan TRĂUȘAN-MATU de la
București
Prof. dr. Amal El-Fallah Universitatea Pierre et
Referent de la
SEGHROCHNI Marie Curie (Paris VI)
Universitatea Pierre
Referent Prof. dr. Michel OCCELLO de la
Mendes-France (Grenoble2)
Bucureşti 2015
v
Acknowledgements
I would like to take the opportunity and use this page to thank the people who have helped
me get to this point in my life. I o(cid:27)er sincere thanks to those who have supported, advised or
otherwise cared for me in any way, such that I may be able to present the work results that
stand before you today.
I would like to thank my PhD supervisors, Professor Adina Magda Florea, Professor Olivier
BoissierandAssociateProfessorGauthierPicard. Theyhavebeeninstrumentalinteachingme
about the daily life of an academic, by letting me learn from their wealth of expertise, keeping
me on the right track all the time, but also pushing me to explore my own interests and (cid:28)nd
my own strengths as a researcher.
I speci(cid:28)cally thank Professor Boissier and Associate Professor Picard for their constant and
insightful feedback, for teaching me to always keep the bigger research picture in mind and for
helping me to improve my skills in writing and structuring research articles.
I give particular thanks to Professor Florea for her constant support in both academic and ad-
ministrativeconcerns,forhertrustinmeasaresearcherandasapersonandforherwillingness
toinvolvemeinmanyprojectswhichhavehelpedmeincreasemyknowledgeinseveralresearch
and software engineering domains.
A big round of thanks goes to all my friends and colleagues who have helped and advised me
and with whom I have had the pleasure of collaborating throughout the years.
I o(cid:27)er sincere gratitude to my friend Andrei Ciortea, who has been a long term collaborator,
advisor and partner in bouncing all sorts of ideas on numerous occasions and projects. The
levelofleadership, dedication, perseveranceandattentiontodetailofwhichhedeemedhimself
capable have inspired me to try and seek out these values myself to the best of my abilities.
Further thanks go to my friends Mihai Trascau and Tudor Berariu who have been my closest
collaborators in the AI-MAS Laboratory. I thank them particularly for taking the time to
debate the speci(cid:28)cs of my work with me and for providing useful advice. I further thank them
for their willingness to engage in interesting discussions about both scienti(cid:28)c and non-scienti(cid:28)c
subjects which have helped me strengthen my existing beliefs, but also broaden my mind to
new ones.
I want to express thanks to Andrei Olaru, Valentin Lungu, Andrei Ismail and all the other
current and former members of the AI-MAS Laboratory with which I had the honour and
pleasure of working together during the past four years.
I wish to thank Reda Yaich, Amro Najjar, Bissan Audeh and Niloufare Sadr from the Hubert
Curien (former ISCOD) Laboratory in Saint-Etienne, who have helped me feel welcome in the
group, have aided me in improving my french speaking skills and who have o(cid:27)ered me advice
and interesting discussions about subjects related to my work, as well as life in general.
Special thanks go to Cristian Stoica and the AQUASoft company who have provided (cid:28)nan-
cial support during the (cid:28)rst year of my thesis and who have introduced me to the world of
entrepreneurship.
Last, but not at all least, I o(cid:27)er deep gratitude to my family, my parents and my brother, for
their support and their sincere belief that I can make them proud, even though I had and still
havemomentsofdoubtinthisregard. Theirloveandcaringhavebeenformeaconstantsource
of strength and inspiration.
From an administrative point of view, the work in this thesis has been funded by the Sectoral
OperationalProgrammeHumanResourcesDevelopment2007-2013oftheMinistryofEuropean
Funds through the Financial Agreement POSDRU/159/1.5/S/134398.
Abstract
The complexity and magnitude of Ambient Intelligence scenarios imply that attributes such
as modeling expressiveness, (cid:29)exibility of representation and deployment, as well as ease of
con(cid:28)guration and development become central features for context management systems.
However,existingworksintheliteratureseemtoexplorethesedevelopment-orientedattributes
at a low degree.
Our goal is to create a (cid:29)exible and well con(cid:28)gurable context management middleware, able to
respond to di(cid:27)erent scenarios. To this end, our solution is built on the basis of principles and
techniques of the Semantic Web and Multi-Agent Systems.
WeusetheSemanticWebtoprovideanewcontextmeta-model,allowingforanexpressiveand
extensible modeling of content, meta-properties (e.g. temporal validity, quality parameters)
and dependencies (e.g. integrity constraints).
In addition, we develop a middleware architecture that relies on Multi-Agent Systems and a
service component based design. Each agent of the system encapsulates a functional aspect of
the context of business processes (acquisition, coordination, distribution, use).
We introduce a new way to structure the deployment of agents depending on the multi-
dimensionalityaspectsoftheapplication’scontextmodel. Furthermore,wedevelopdeclarative
policies governing the adaptation behavior of the agents managing the provisioning of context
information.
Simulationsofanintelligentuniversityscenarioshowthatappropriatetoolingbuiltaroundour
middlewarecanprovidesigni(cid:28)cantadvantagesintheengineeringofcontext-awareapplications.
vii
Contents
Abstract vii
Introduction 1
Motivation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1
Objectives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2
Thesis Structure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2
1 Problem De(cid:28)nition 5
1.1 What is Ambient Intelligence . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
1.1.1 De(cid:28)ning the Field . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
1.1.2 Scenarios . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8
1.2 What is Context Management . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
1.2.1 What is Context . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
1.2.2 Challenges in Deploying Context-Aware Applications . . . . . . . . . . . . 11
1.2.3 Challenges in Controlling Context-Aware Applications . . . . . . . . . . . 13
1.2.4 Challenges in Modeling Context Information . . . . . . . . . . . . . . . . 14
1.3 Reference Scenario . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14
2 A State of the Art in Context Modeling 17
2.1 Representing Context Information . . . . . . . . . . . . . . . . . . . . . . . . . . 17
2.1.1 Context Representation Requirements . . . . . . . . . . . . . . . . . . . . 18
2.1.2 Context Representation Methods . . . . . . . . . . . . . . . . . . . . . . . 19
2.1.3 Ontology-based Context Representation . . . . . . . . . . . . . . . . . . . 22
2.1.4 Representation using Context Meta-Models . . . . . . . . . . . . . . . . . 25
2.1.5 Context Representation Summary . . . . . . . . . . . . . . . . . . . . . . 27
2.2 Reasoning about Context Information . . . . . . . . . . . . . . . . . . . . . . . . 28
2.2.1 Reasoning Concerns . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
2.2.2 Categories of Context Reasoning . . . . . . . . . . . . . . . . . . . . . . . 30
2.2.3 Ontology-based Reasoning . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
2.2.4 Rule-based Reasoning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32
2.2.5 Other Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34
2.2.6 Context Reasoning Summary . . . . . . . . . . . . . . . . . . . . . . . . . 35
2.3 Our Context Modeling Objectives . . . . . . . . . . . . . . . . . . . . . . . . . . 36
3 Advances in Context Management Systems 38
3.1 Provisioning Context Information . . . . . . . . . . . . . . . . . . . . . . . . . . . 38
3.1.1 Operational Aspects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39
3.1.2 Non-Functional Aspects . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41
3.1.3 Context Provisioning Architectures . . . . . . . . . . . . . . . . . . . . . . 42
3.1.4 Context Provisioning Summary . . . . . . . . . . . . . . . . . . . . . . . . 44
3.2 Deploying Context Management Solutions . . . . . . . . . . . . . . . . . . . . . . 46
3.2.1 Deployment Concerns . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46
viii
CONTENTS ix
3.2.2 Deployment Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48
3.2.3 Deployment Summary . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
3.3 Our Context Management Objectives. . . . . . . . . . . . . . . . . . . . . . . . . 51
4 Representing and Reasoning About Context 53
4.1 CONSERT Context Formal Model . . . . . . . . . . . . . . . . . . . . . . . . . . 53
4.1.1 Representation Concepts. . . . . . . . . . . . . . . . . . . . . . . . . . . . 53
4.1.2 Reasoning Formalism . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58
4.1.3 Context Dimensions and Context Domains . . . . . . . . . . . . . . . . . 60
4.2 Ontology-based Meta-Model . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63
4.2.1 Content Representation . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64
4.2.2 Annotation Representation . . . . . . . . . . . . . . . . . . . . . . . . . . 66
4.2.3 Constraint Representation . . . . . . . . . . . . . . . . . . . . . . . . . . . 68
4.3 Rule-based Context Inference . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70
4.3.1 Context Derivation Rules . . . . . . . . . . . . . . . . . . . . . . . . . . . 70
4.3.2 Context Consistency . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73
4.4 Reasoning Engine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74
4.4.1 Architecture . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75
4.4.2 Execution Cycle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76
4.5 Discussion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78
4.5.1 Analysis of Modeling Contributions . . . . . . . . . . . . . . . . . . . . . 78
4.5.2 Analysis of Reasoning Contributions . . . . . . . . . . . . . . . . . . . . . 80
5 Adaptable Context Provisioning 82
5.1 Multi-Agent Based Architecture. . . . . . . . . . . . . . . . . . . . . . . . . . . . 82
5.1.1 Rationale . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83
5.1.2 Context Provisioning Agents . . . . . . . . . . . . . . . . . . . . . . . . . 84
5.1.3 Context Provisioning Agent Environment . . . . . . . . . . . . . . . . . . 86
5.2 Context Provisioning Agent Policies . . . . . . . . . . . . . . . . . . . . . . . . . 86
5.2.1 Sensing Policies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87
5.2.2 Coordination Policies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88
5.3 Context Provisioning Policy Execution . . . . . . . . . . . . . . . . . . . . . . . . 90
5.3.1 Gathering Provisioning Statistics . . . . . . . . . . . . . . . . . . . . . . . 91
5.3.2 Control Process . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91
5.4 Context Provisioning Interactions . . . . . . . . . . . . . . . . . . . . . . . . . . . 93
5.4.1 Provisioning Sensing Chain . . . . . . . . . . . . . . . . . . . . . . . . . . 93
5.4.2 Provisioning Request Chain . . . . . . . . . . . . . . . . . . . . . . . . . . 95
5.5 Discussion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 96
6 Flexible Deployment of Context Provisioning 99
6.1 Deployment: A Domain-Based View . . . . . . . . . . . . . . . . . . . . . . . . . 99
6.1.1 Using ContextDimensions and ContextDomains . . . . . . . . . . . . . . . 100
6.1.2 Using ContextDomain Hierarchies . . . . . . . . . . . . . . . . . . . . . . 102
6.1.3 CONSERT Middleware Deployment Schemes . . . . . . . . . . . . . . . . 102
6.2 Deployment Policies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103
6.2.1 Platform Con(cid:28)guration . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104
6.2.2 ContextDomain Con(cid:28)gurations . . . . . . . . . . . . . . . . . . . . . . . . 104
6.2.3 Agent Con(cid:28)gurations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106
6.3 Managing Deployment: the OrgMgr agent . . . . . . . . . . . . . . . . . . . . . . 107
6.3.1 Launching Platform and CMUs . . . . . . . . . . . . . . . . . . . . . . . . 107
6.3.2 OrgMgr Roles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108
6.3.3 Initialization and Provisioning Agent Setup . . . . . . . . . . . . . . . . . 109
6.4 Distributed Deployment Usage . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110
6.4.1 Domain Query Management. . . . . . . . . . . . . . . . . . . . . . . . . . 110