Waging war on physical inactivity: using modern molecular ammunition against an ancient enemy Frank W. Booth, Manu V. Chakravarthy, Scott E. Gordon and Espen E. Spangenburg J Appl Physiol 93:3-30, 2002. doi:10.1152/japplphysiol.00073.2002 You might find this additional info useful... This article cites 263 articles, 96 of which can be accessed free at: /content/93/1/3.full.html#ref-list-1 This article has been cited by 53 other HighWire hosted articles, the first 5 are: Should obesity be considered a disease? Lee Stoner, Kim Gaffney, Daniel Wadsworth and Rachel Page Perspectives in Public Health, November , 2014; 134 (6): 314-315. [Full Text] [PDF] Can sedentary behaviour be considered a cultural maladaptation? Daniel Wadsworth, Mikell Gleason and Lee Stoner Perspectives in Public Health, January , 2014; 134 (1): 20-21. [Full Text] [PDF] ''Anthropogens'' in Lifestyle Medicine Garry Egger, David Colquhoun and John Dixon DD AMERICAN JOURNAL OF LIFESTYLE MEDICINE, December 5, 2013; . oo ww [Abstract] [Full Text] [PDF] nn lolo aa dd Physical Activity and Body Mass Perception ee dd CDlairnr iNn uWrs. RAensd, eArsuognu,s St r, .2 a0n1d2 ;J o2s1e p(3h) :R 2. 5L2i-b2o6n7a.ti fro fro mm [Abstract] [PDF] o o nn The burden of physical inactivity in chronic kidney disease: is there an exit strategy? Fe Fe Fabio Manfredini, Francesca Mallamaci, Luigi Catizone and Carmine Zoccali brubru Nephrol. Dial. Transplant., June , 2012; 27 (6): 2143-2145. aa [Full Text] [PDF] ryry 4 4 , 2, 2 00 11 Updated information and services including high resolution figures, can be found at: 55 /content/93/1/3.full.html Additional material and information about Journal of Applied Physiology can be found at: http://www.the-aps.org/publications/jappl This information is current as of February 4, 2015. Journal of Applied Physiology publishes original papers that deal with diverse areas of research in applied physiology, especially those papers emphasizing adaptive and integrative mechanisms. It is published 12 times a year (monthly) by the American Physiological Society, 9650 Rockville Pike, Bethesda MD 20814-3991. Copyright © 2002 by the American Physiological Society. ISSN: 0363-6143, ESSN: 1522-1563. Visit our website at http://www.the-aps.org/. JApplPhysiol93:3–30,2002; 10.1152/japplphysiol.00073.2002. invited review Waging war on physical inactivity: using modern molecular ammunition against an ancient enemy FRANK W. BOOTH,1 MANU V. CHAKRAVARTHY,2 SCOTT E. GORDON,3 AND ESPEN E. SPANGENBURG1 1Departments of Veterinary Biomedical Sciences and Physiology and the Dalton Cardiovascular Institute, University of Missouri, Columbia, Missouri 65211; 2Department of Internal Medicine, University of Pennsylvania, Philadelphia, Pennsylvania 19104; and 3Departments of Exercise and Sports Sciences and of Physiology and the Human Performance Laboratory, East Carolina University, Greenville, North Carolina 27858-4353 Booth,FrankW.,ManuV.Chakravarthy,ScottE.Gordon,and Espen E. Spangenburg. Waging war on physical inactivity: using D o modernmolecularammunitionagainstanancientenemy.JApplPhysiol w 93: 3–30, 2002; 10.1152/japplphysiol.00073.2002.—A hypothesis is pre- nlo sented based on a coalescence of anthropological estimations of Homo a d sapiens’ phenotypes in the Late Paleolithic era 10,000 years ago, with e d Dtharrifwtyinigaennen.atIutraislsperloepctoisoendsythnaetrghizuemdawnisthinNheeerli’steiddegaeonfetshethsaot-cawlelerde from evolved to support a physically active lifestyle. It is further postulated o that physical inactivity in sedentary societies directly contributes to n F multiplechronichealthdisorders.Therefore,itisimperativetoidentify e b theunderlyinggeneticandcellular/biochemicalbasesofwhysedentary ru living produces chronic health conditions. This will allow society to a ry improve its ability to effect beneficial lifestyle changes and hence im- 4 prove the overall quality of living. To win the war against physical , 2 inactivityandthemyriadofchronichealthconditionsproducedbecause 0 1 of physical inactivity, a multifactorial approach is needed, which in- 5 cludessuccessfulpreventivemedicine,drugdevelopment,optimaltarget selection,andefficaciousclinicaltherapy.Alloftheseapproachesrequire athoroughunderstandingoffundamentalbiologyandhowthedysregu- lated molecular circuitry caused by physical inactivity produces clini- callyovertdisease.Thepurposeofthisreviewistosummarizethevast armamentarium at our disposal in the form of the extensive scientific basis underlying how physical inactivity affects at least 20 of the most deadly chronic disorders. We hope that this information will provide readerswithastartingpointfordevelopingadditionalstrategiesoftheir ownintheongoingwaragainstinactivity-inducedchronichealthcondi- tions. exercise;disease;mechanism;genes;evolution UPDATE ON THE WAR AGAINST CHRONIC DISEASE: and human suffering (103). The good news is that THE GOOD NEWS AND THE BAD exerciseinterventionandexercisebiologyarevitaland potentially effective components of our arsenal in the Our society is currently at war against the ominous war on chronic disease. In a previous call to arms in enemy of chronic disease. Chronic disease presents a heavyburdentosociety,intermsofbothmedicalcosts thisfight(25),wereviewedtheoverwhelmingepidemi- ological evidence linking most chronic diseases to the riseinphysicalinactivityduringthepastcentury.The Address for reprint requests and other correspondence: F. W. bad news is that exercise and exercise biology appear Booth, Univ. of Missouri, Dept. of Veterinary Biomedical Sciences, to be the least used weapons in our arsenal. It is our E102Vet.Med.Bldg.,1600E.Rollins,ColumbiaMO65211(E-mail: [email protected]). perception that 1) much of the medical community http://www.jap.org 8750-7587/02$5.00Copyright©2002theAmericanPhysiologicalSociety 3 4 INVITEDREVIEW underpractices primary prevention as it pertains to changetoonethatstrivestounderstandthemolecular appropriatelevelsofphysicalactivityforhealthand2) mechanismsofdiseaseinducedbyasedentarylifestyle much of the research community undervalues the im- acting on a genome programmed for physical activity. portanceofunderstandingthecellular,molecular,and In summary, at the start of the new millennium, we geneticbasesofdiseasescausedbyphysicalinactivity. areuniquelypoisedtowagewaragainstphysicalinac- For many, exercise is viewed solely as a research or tivity by using the modern ammunition of cellular, diagnostic tool and not as a true weapon against biochemical,andmolecularbiologicalbreakthroughsof chronic disease. In reality, however, exercise attacks the 21st century to begin dissection of the underlying therootsofchronicdisease,thatis,physicalinactivity. mechanismsconcerningtheimpactofphysicalactivity For us to follow a common battle plan, there is an on health. apparentneedtoconvincethemedicalcommunitythat This review does not intend to be inclusive by pro- chronicdiseaseisrootedinphysicalinactivity.Thus,in viding all known information for each inactivity-re- this review, we focus on these roots by compiling the lated disorder; rather, we have chosen a portion of scientific evidence to date showing the biological basis those papers supporting the role of inactivity in dis- ofhowphysicalinactivityleadstochronicdisease.One ease. Although we attempted an unbiased selection of purpose of this review is to demonstrate that exercise material and believe that this is a fair presentation, is more than a tool, such as in treadmill testing of thereaderneedstobecautionedthatourpassioncould humans for cardiac dysfunctions. To address these unintentionally affect our objectivity. The reader also misconceptions,anumberofweaponswillbeemployed needs to be cautioned that the less than exhaustive in this review. coverage of each disease means that the reader will havetotakewhatispresentedasonlyastartingpoint for further study. The authors thus apologize for the BATTLE PLAN TO PROVE THE DEPTH OF possible omission of any specific references. KNOWLEDGE FOR EACH CHRONIC HEALTH CONDITION AFFECTED BY PHYSICAL INACTIVITY PHYSICAL ACTIVITY IS PROGRAMMED INTO OUR Do w The first portion of this review details the concept GENOMES FROM THE LATE PALEOLITHIC ERA1 n lo that the human genome has been evolutionarily pro- Allthatwecando,istokeepsteadilyinmindthat a d grammedforphysicalactivity.Thestrategyistoshow eachorganicbeingisstriving...thateachatsome e d that physical inactivity interacts directly with the ge- period of its life, during some season of the year, fro nome and thus that physical inactivity is an initiating during each generation or at intervals, has to m factorinthemolecularmechanismsofdisease.Next,in struggle for life and to suffer great destruction. o n thelongestportionofthisreview,agenericbattleplan Whenwereflectonthisstruggle,wemayconsole F e for each health condition is presented, with each plan ourselves with the full belief, that the war on b consisting of three distinct rounds of discussion. First, nature is not incessant, that no fear is felt, that rua a short synopsis of epidemiology for that condition is deathisgenerallyprompt,andthatthevigorous, ry 4 given.Thestrategyistodocumenttheepidemiological thehealthy,andthehappysurviveandmultiply. , 2 evidence that physical inactivity does increase the (Charles Darwin, The Origin of Species) 0 1 prevalence of the particular health condition. Second, 5 intermediatemechanismsbywhichphysicalinactivity From Darwin’s (48) seminal work, we have now inducestheonsetoftheparticularconditionaregiven. accrued the scientific basis for the notion of how envi- Third, the cellular/molecular mechanisms, if known, ronmentalforcesdirectlymodifythefatesofgenesand arepresented.Ourstrategyistoprovethat,asformost how in turn that inextricable connection remains in- inactivity-relatedchronichealthconditions,asolidcel- tertwined and integrated with our day-to-day exis- lular/molecular mechanism of how physical inactivity tence. Those fundamental concepts are now refined increases disease prevalence does exist. To reinforce and applied to the understanding of how the environ- the impact of the final discussion, speculation, when mental-genetic interaction molds our susceptibility, reasonable, is presented as to how physical inactivity ourselection,and,asweshalldescribehere,ourstrug- might drive an inappropriate expression from a ge- gle against the onslaught of modern chronic diseases. nome that had been evolutionarily programmed for Indeed, environmental factors have been identified as morephysicalactivitythanexistsinmodernAmerican 58–91% of causal factors for three of the most domi- culture. In addition, our battle plan includes a large nantchronichealthconditionsafflictingindividualsin number of chronic health conditions whose prevalence modern-day America: Type 2 diabetes, coronary heart is increased by physical inactivity. Our strategy is to disease, and most site-specific cancers (113, 153, 227). overrun disbelievers’ defenses by the sheer mass of This is a dramatic shift in the preponderance of inci- conditions influenced by physical inactivity. dence of such conditions that once were very rare. Theapproachhereistodocumenttheneedtounder- There is now unequivocal evidence in the literature stand the mechanisms of chronic health conditions supporting the notion that all environmental factors produced by physical inactivity, just as it is legitimate tounderstanddiseasemechanismsforatherosclerosis, 1DuringtheLatePaleolithicperiod(50,000–10,000BC),humans cancer,andType2diabetes.Thisbattlewillbeconsid- existedashunter-gatherers,usingrudimentarychippedstonetools, ered won if the emphasis of biological research would andarethussaidtohavelivedintheso-calledoldstoneage(55). JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org INVITEDREVIEW 5 combined, including physical inactivity (defined here chronic because they are slow in progression and long astheactivityequivalentof(cid:1)30minofbriskwalking/ in continuance (53)]. A Scandinavian twin study (153) day), account for the majority of chronic health condi- showed that 58–100% of site-specific cancers had an tions (153) [these conditions are characterized as environmental origin. The Harvard Center for Cancer Preventionina1996report(95)estimatedthat,ofthe total number of cancer deaths, 30% were due to to- bacco,30%toadultdietandobesity,5%tooccupational factors,and2%toenvironmentalpollution.Thisreport predated much of the work regarding exercise’s pre- ventive effect on many site-specific cancers. A total of 91%ofthecasesofType2diabetes(113)and82%(227) of the coronary artery disease cases in 84,000 female nursescouldbeattributedtohabitsandso-calledhigh- riskbehavior[definedbythestudyasbodymassindex (BMI) (cid:2)25, diet low in cereal fiber and polyunsatu- rated fat and high in transfat and glycemic load, a sedentary lifestyle, and currently smoking]. Thus the majority of deaths from chronic health conditions in theUnitedStatesareofenvironmentalorigin.Physical inactivity is the third leading cause of death in the UnitedStatesandcontributestothesecondleadingcause (obesity),accountingforatleast1in10deaths (88). Studiesshowedthat(cid:3)30–50%ofallcasesofType2 diabetes, coronary heart disease, and many cancers D were prevented by 30 min of moderate-intensity exer- o w cise each day in middle-aged women (e.g., walking (cid:2)3 n lo miles/h) compared with cohorts who exhibited lower a d levels of physical activity (42, 113, 165). Hence, the e d questionarises:howdoesanenvironmentalfactorsuch fro as physical inactivity trigger the underlying intrinsic m genetic composition of an individual to induce suscep- o n tibilitytosuchdetrimentalhealthconditions,whenour F e genes have been programmed for maximal preserva- b ru tion by natural selection? a Toprovideanevolutionary-genetichypothesistothe ry 4 above question, we will focus on physical activity and , 2 how a sedentary lifestyle is a potent environmental 0 1 trigger for the development of several chronic health 5 conditions as detailed above. Environmental factors are thought to exert their influence by altering the expressionofasubpopulationofgenesthatresultsina phenotype that passes a threshold of biological signif- icance to where overt clinical symptoms appear (the pathological state) (17) (Fig. 1). Physical inactivity constitutes an important component of these environ- mental factors. Modern Homo sapiens are still geneti- callyadaptedtoapreagriculturalhunter-gathererlife- Fig.1. Demonstrationoftheconceptthatphysicalinactivityalters normalgeneexpression,whichproducesapatternofproteinexpres- sionthatapproachesthethresholdofphysiologicalsignificance.This threshold is passed if susceptibility gene X and physical inactivity arepresent,therebyallowingforthedevelopmentofanovertclinical disease.A:appropriatephysicalactivitymovesgeneexpressionaway fromathresholdatwhichsymptomsofovertclinicaldisordersoccur. B:physicalinactivityalonemovesthephenotypetowardthethresh- oldofclinicaldisorders.C:agenepolymorphismalonepredisposesa person to a clinical disorder (susceptibility gene X) and moves the phenotypetowardthethresholdforovertclinicaldisorders.D:dual presence of a susceptibility gene X and physical inactivity causes geneexpressiontopassthethresholdofphysiologicalsignificanceat arapidrate,allowingforovertclinicaldisorderstooccur. JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org 6 INVITEDREVIEW style(67)becausetheoverallgeneticmakeupofHomo insulin resistance in muscle would have the effect of sapienshaschangedlittleduringthepast10,000years blunting the hypoglycemia that occurs during fasting, (56).Hunter-gatherersocietieslikelyhadtoundertake which suggested to them a survival advantage during moderate physical activity for more than 30 min each periods of food shortage. The current literature sug- day to provide basic necessities, such as food, water, geststhattheplasticityofmanyofthesamemetabolic shelter,materialsforwarmth,andsoforth,tosurvive. proteinsfoundwithnutritionalstate(57,218)extends One can speculate, although not prove, that any phe- to physical activity (105, 202). Because inactive skele- notypepreventingahunter-gathererfromengagingin talmusclesinperiodsoffaminedonotrequireasmuch physical activity would increase the likelihood of the bloodglucose,wespeculatethatthepathwaysconserv- randomeliminationofthisorganismoritsoffspringat ing the uptake of blood sugar into an inactive skeletal sometime.Ontheotherhand,aphenotypethatwould musclewereprogrammedintothehumangenomedur- support moderate physical activity by allowing a ing the Late Paleolithic era. Furthermore, we propose greater capacity for flux of substrates for ATP produc- that the exercise-induced enhancement of glucose up- tiontofuelphysicalworkwouldhavebeenmorelikely take only into contracting muscle evolved to overcome to survive, and its gene pool would be transferred to muscle insulin resistance to permit the physical activ- future generations. In essence, we are extending Dar- ityassociatedwithfoodgatheringinperiodsoffamine. winianthought(169)toincludeaconceptthatrandom Thusthepresentinterpretationsofalterationsingene elimination is less likely to occur during the hunter- expression with changes in daily physical activity gatherereraforphenotypesthathadahighcapacityto should consider their potential origins of being pro- support increased metabolic rates during moderate grammed into the human genome as survival mecha- physical work. Thus it is likely that many metabolic nismsduringtheLatePaleolithicperiod.Assuch,they featuresofmodernhumansevolvedasanadaptationto are more than the current faddish description of an aphysicallyactivelifestyle,coupledwithadiethighin environmental perturbation of genes; rather, they protein and low in fat, interspersed with frequent pe- should be thought of as a constitutive function for D riods of famine (67, 257). normalgenefunction.Inotherwords,physicalinactiv- ow ity is an abnormal event for a genome programmed to n lo The “Thrifty Gene” Hypothesis Applied expect physical activity, thus explaining, in part, the ad to Physical Activity genesis of how physical inactivity leads to metabolic ed dysfunctionsandeventualmetabolicdisorderssuchas fro Theconceptofcyclesoffeastandfamineengendered atherosclerosis,hypertension,obesity,Type2diabetes, m Neel’s(186)“thriftygene”hypothesis.Accordingtothis and so forth (Fig. 2). o n hypothesis, those individuals with “thrifty” metabolic Daily physical activity was an integral, obligatory F e adaptations would convert more of their calories into aspect of our ancestor’s existence (45). The weekly b adipose tissue during periods of feasting (41). As a rua consequence, those with the thrifty phenotype would ry 4 belesslikelytoberandomlyeliminatedduringperiods , 2 offoodshortage(257),i.e.,duringperiodsoffeastthey 0 1 wouldbethriftyandstoremorefoodcaloriesasfatdue 5 to their thrifty metabolic processes. The ability of an organism to adapt to a lowering of energy intake is beneficial to survival (218). This concept also implies the cycling of metabolic processes with the fluxes in feast and famine. A reduction in energy intake below anacceptablelevelofrequirementresultsinaseriesof physiological, biochemical, and behavioral responses, which are an adaptation to the low-energy intake (218). One of these is atrophy of skeletal muscle whereinmuscleproteinisdegradedasacarbonsource for gluconeogenesis by the liver. Malnutrition is also associated with a behavioral decrease in spontaneous, free-living physical activity (218). Because inactivity producesmuscleatrophy,wespeculateanevolutionary Fig. 2. Biological basis for the hypothesis that the human genome origin for the selection of genes that respond to physi- requiresphysicalactivitytomaintainhealthisdepicted.Wespecu- cal inactivity and activity in the control of muscle late that the human genome evolved to support higher metabolic rates and strength activities of a physically active lifestyle. The protein expression. human genome has remained largely unchanged during the past Plasticity of metabolic pathways in skeletal muscle 10,000years.However,wefurtherspeculatethattherecentoccur- likely provides an adaptive advantage during periods rence of a more physically inactive lifestyle does not maintain the of famine and physical inactivity. Wendorf and Gold- required metabolic fluxes and muscle loading. As a consequence, genes expecting physical activity for normal function have altered fine (257) proposed that the thrifty phenotype in Type expression such that the resultant phenotype induces a cross of a 2 diabetes could in fact be (or contribute to) insulin threshold of clinical significance whereby overt clinical disorders resistance seen in muscle. They wrote that a selective appear. JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org INVITEDREVIEW 7 activity pattern of hunter-gatherers in this century activity phenotype with the maintenance of the evolu- followed what has been called a Paleolithic rhythm of tionarily conserved thrifty phenotype. This would al- days of fairly intense physical activity that alternated lowforamanifestationofmetabolicdysfunctioninthe with days of rest and light activity: men commonly formofinsulinresistance,whichisanunderlyingpart hunted from 1–4 nonconsecutive days a week with of syndrome X [the metabolic or insulin resistance interveningdaysofrestandwomenroutinelygathered syndromeofatherosclerosis,hypertension,andType2 every 2 or 3 days (214). Other activities involving diabetes (93)]. physical labor included tool making, butchering and other food preparation, preparing clothing, carrying Physical Activity Is a Prerequisite for Normal firewood and water, and moving to new campsites Physiological Gene Expression Based on the (214).Dances(oftenlastinghours)wereamajorrecre- Following Reasoning ational activity in many cultures, often taking place several nights per week (214). Skeletal remains from The condition of physical inactivity often extends preagricultural hunter-gatherers showed that they beyondabenignmetabolicdysfunctiontoapathophys- had habitual activity that made them more muscular iological condition. Human cells are maladapted to an andstrongerthanpostagriculturalsociety(56).Today, inactive lifestyle. The variety of polymorphisms in the most Americans are quite weak relative to our ances- aforementioned polygenetic diseases set diversity in tors, possibly contributing to the premature onset of thethresholdforobtainingbiologicalsignificanceclas- physical disability (226). sifiedaspathology.ExtrapolatingfromtheLatePaleo- The estimated caloric expenditure of daily physical lithicculture,onemightreasonthatperhapsevolution activityismuchlesstodaythaninthehunter-gatherer has programmed phenotypes to undertake a quantity society. The total energy expenditure of contemporary of metabolic fluxes to support a physically active life- humans is (cid:3)65% that of Late Paleolithic Stone Agers, style.Duringperiodsofinactivity,somemetabolicpro- with the assumption that comparisons to modern day cesses involved in the oxidation of substrates could D foragers are feasible (45). However, when differences become underused with a consequent dysfunction in o w inbodysizeareconsidered,theenergyexpenditureper metabolicprocessesrelatedtoenergystorage.Thusthe n lo unit body mass for physical activity for contemporary often-perceived notion that being sedentary has no a d American adults is (cid:3)38% that of our smaller human adverse clinical effect has no biological basis to it and e d ancestors (45). The 30 min of moderate exercise daily hence is false. However, it is likely that humans have fro in present guidelines results in expenditure of only anintrinsicbiologicalrequirementforacertainthresh- m 44%ofthecaloriesoftwo20thcenturyhunter-gatherer oldofphysicalactivity,withasedentarylifestylebeing o n societies,whichaccordingtoCordainetal.(45)ismuch a disruption of the normal homeostatic mechanisms F e below estimates for calories expended in preagricul- programmedforpropermetabolicfluxneededtomain- b tural human ancestors. Cordain et al. wrote that the tain health. Neel (187) describes this process with the rua current level of physical activity is “very likely, below conceptof“syndromesoffailedgenetichomeostasis”by ry 4 thelevelofphysicalexertionforwhichourgenetically- increased periods of physical inactivity, which offsets , 2 determined physiology and biochemistry have been the necessary homoeostatic balance governing energy 0 1 programmed through evolution.” input and utilization and perhaps could ultimately 5 Adults in the present United States have Late Pa- lead to the chronic metabolic syndrome manifested as leolithicpreagriculturalhunter-gatherergenesbutlive syndrome X. Thus it behooves the health of modern in a sedentary, food-abundant society whose appear- society to alter their environmental influences such anceasacultureislessthan200yearsold(56).Eaton that they maximize their “positive selection” and min- et al. (56) contend that there is now a mismatch be- imize “random elimination.” tween our ancient, genetically controlled biology and The importance of understanding the molecular ba- certainaspectsofourdailylives.Thethriftyphenotype sis for disease is unequivocally clear. For example, is now disadvantageous in sedentary individuals who Francis Collins wrote (43) are allowed free access to food (257). They store fat in For me, as a physician, the true payoff from the anticipation of a famine that does not come because Human Genome Project will be the ability to foodisavailableondemand.Someofthosewhodevelop better diagnose, treat, and prevent disease, and obesity and Type 2 diabetes likely have the thrifty mostofthosebenefitstohumanitystilllieahead. phenotype.Eatonetal.maintainthatthisdiscordance With these immense data sets of sequence and promotes chronic degenerative disorders that have variationnowinhand,wearenowempoweredto their main clinical expression in the postreproductive pursue those goals in ways undreamed of a few period and account for (cid:3)75% of deaths in the United years ago. If research support continues at vigor- States.Wewouldalsoliketoextendtheconceptofthe ous levels, it is hard to imagine that genomic maladaptationofthe“thriftyphenotype”tothemalad- science will not soon reveal the mysteries of he- aptation of the “activity phenotype.” Metabolic pro- reditaryfactorsinheartdisease,cancer,diabetes, cesses in the body have evolved to support physical mental illness, and a host of other conditions. activity. When physical inactivity is present during states of continuous feeding, as is the norm in the We hope that our presentation in this review will United States today, there is a downregulation of the demonstrate that physical activity should be added to JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org 8 INVITEDREVIEW Collin’s list of hereditary factors, as we have inherited CARDIOVASCULAR DISEASES agenomeprogrammedforphysicalactivity,andphys- Heart Disease: Coronary Artery Disease, Angina, ical inactivity precedes some of the onset of heart and Myocardial Infarction disease, cancer, diabetes, and mental illness. Genomic science, as described by Collins, can only be a part of Evidencethatinactivityincreasesincidence.TheEx- hiscallforbetterpreventionofdisease.Understanding pertPanelonDetection,Evaluation,andTreatmentof the popularized “gene-environmental” interaction will High Blood Cholesterol in Adults (61) concluded on provide the most effective prevention of disease. evidence-based medicine As delineated above, major “environmental” factors of the Late Paleolithic era set the level of physical Physicalinactivityislikewiseamajor,underlying activity required by genes to maintain a healthy met- risk factor for coronary artery disease. It aug- abolic function. Therefore, without that threshold of ments the lipid and non-lipid risk factors of the physical activity expected by our genomes (secondary metabolicsyndrome.Itfurthermayenhancerisk to our current sedentary lifestyles), physiological dys- by impairing cardiovascular fitness and coronary function is likely to occur from pathological gene ex- bloodflow.Regularphysicalactivityreducesvery pression, eventually leading to chronic health condi- low-densitylipoproteinlevels,raisesHDLcholes- tions. We agree with Francis Collins’ vision that terol, and in some persons, lowers LDL levels. It genomicsciencewillrevealthemysteriesofthehered- also can lower blood pressure, reduce insulin re- itary factors of heart disease, cancer, and Type 2 dia- sistance, and favorably influence cardiovascular betes, and we support research regarding this vision. function.Thus,ATPIIIrecommendsthatregular However,thesediseaseswillcontinuetooccuruntilwe physical activity become a routine component in unravel the mysteries of the inherently enmeshed in- management of high serum cholesterol. terplay of genetics and environment, particularly re- garding how environmental factors such as physical Cardiovascular disease was the primary cause of D o inactivity modify Late Paleolithic heredity to produce 949,619deaths(41%ofalldeaths)intheUnitedStates w n much of the premature death and suffering seen in in 1998. Inactivity contributed to these deaths. For lo present-day human society (Fig. 2). Thus we propose example,30%ofcoronaryheartdiseaseandstrokewas ade dhuowal-tthraecikntreersaecatriochntbheatwt ienecnluoduersegnevnioromnimc secnitenacnedagned- pwreeevke,nctoemdpbayr2e.d5whitohf btrhiosskewwahlkoinpger(f(cid:2)or3mmedilelse/shs)tehaachn d from nome occurs. A more complete vision of the human thisamountofphysicalactivityinalargepopulationof o genomeprojectwouldbetouseeverypossibleapproach n in the war against chronic health conditions and not Harvard nurses (115, 165). If the preventive effects of Fe undertaking moderate-intensity physical activity [i.e., b lniimsmitsr.esearch to only a portion of the possible mecha- activity performed at three to six times the basal met- rua abolicrate,whichistheequivalentofbriskwalkingat ry 4 HEALTH CONSEQUENCES OF PHYSICAL INACTIVITY 3si–m4ilmarilefosr/haflolrcamuossetshoefalctahrydiaodvuasltcsul(a1r97d)i]sweaesree,ttohebne , 20 1 Physically Active Humans Are in the Control Group 284,886 deaths from cardiovascular disease would be 5 Based on Genotype and Phenotype prevented (12% of all deaths in the United States). Intermediate mechanisms. A key cell type through Fromtheinformationpresentedintheprevioussec- whichinactivitymediatesitseffectsonbloodvesselsis tion,thisreviewwillbepresentedfromtheperspective likely the endothelial cell. Evidence is accumulating that the control or normal phenotype in humans is a that endothelial dysfunction is the initiating event in physically active lifestyle, because current genes the development of atherosclerosis (212). Indeed, as- evolved from physically active humans. From the sessing endothelial function has become an important standpoint of our Late Paleolithic ancestors, physical tool for detection of preclinical cardiovascular disease inactivity is abnormal; it can produce a pathophysio- (8).Thepresentdatapointtotheconceptthatphysical logical phenotype and is a major contributor to the inactivityproducesendothelialdysfunction,inpart,by chronic health conditions of 2002. The purpose of this diminishingthenumberofpulsatileincreasesinblood review is to convince readers that the present knowl- flow through coronary blood vessels (see Ref. 26 for edgeoncellular/molecularadaptationsrelatedtophys- references). The lack of shear stresses produced from icalinactivityisonlypreliminaryandtoconvinceread- ersthatmechanismsofinactivityaredirectlyinvolved theabsenceofexercise-inducedincreasesinbloodflow inthepotentiationofseveralchronichealthconditions. removes the stimulus for vasodilation (acute) and An understanding of molecular mechanisms of disease, structural enlargement (chronic) adaptations. In addi- includingthoseelicitedbyphysicalinactivity,isneces- tiontoitseffectsonbloodflow,physicalinactivityalso sary for a complete understanding of chronic health enhances endothelial dysfunction indirectly through conditionsandtomaximizetheirprevention.Thenext itsmodulationofthebloodlevelsofcertainmetabolites section of this review highlights the role of inactivity- and hormones (1). The prevalence of some clinical related mechanisms in several chronic health condi- conditions that depress endothelial function is en- tions. hanced by physical inactivity. For example, 1) obesity JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org INVITEDREVIEW 9 and insulin resistance are associated with blunted en- arterial stiffness is not well understood. Sedentary dothelium-dependent but not endothelium-indepen- individuals have a reduced large-artery compliance, dent vasodilation (9); furthermore, hyperinsulinemia i.e.,stiffervessels,thandoendurance-trainedcounter- fails to augment endothelium-dependent vasodilation parts(130,179,233,247).Aerobicfitness,totalcholes- (228); 2) patients with Type 1 or 2 diabetes have sig- terol,andLDLcholesterolwerefoundtobesignificant nificant abnormalities in endothelial function (1); and independentphysiologicalcorrelatesofcentralarterial 3) low blood high-density lipoprotein (HDL) is associ- stiffnessinhealthywomenvaryinginageandphysical ated with endothelial vasomotor dysfunction (269), as activity status (233). therapies that increase HDL may improve endothelial Exercise also appears to exert an acute protective vasomotorfunctionindependentoflow-densitylipopro- effectinheartmuscle.Asingle30-minboutofrunning tein (LDL) cholesterol (60). Hypercholesterolemia, di- by rats on a treadmill conferred a cardioprotective abetes mellitus, and hypertension are associated with effect on the myocardium that resulted in a limitation reducedsynthesisand/or increased degradation of vas- ofinfarctsize24hlater(266).Pharmacologicalinhibi- cular nitric oxide (NO) (152), which reduces the vessel tion of protein kinase C (PKC) activation during the diameters.ThereductionintheactivityofvascularNO exercise period abrogated this protective response is also likely to play a significant role in the develop- (266). Exercise has also been shown to reduce is- ment of atherosclerosis. Exercise ameliorates these chemia-reperfusioninjurytotheheartofratsbyupregu- disease processes through its action of increasing NO latingtumornecrosisfactor(TNF)-(cid:4),interleukin-1(cid:4),and productioninendothelialcells(128).Exercisetraining manganese-superoxidedismutase(MnSOD),allofwhich ofpatientswithcoronaryarterydiseaseattenuatedthe are known to be cardioprotectants (267). MnSOD is an paradoxical vasoconstriction in response to acetylcho- intrinsicradicalscavenger,whereasTNF-(cid:4)andinterleu- line by improving the endothelium-dependent vasodi- kin-1(cid:4)areinducersofMnSOD(267). latation in both epicardial coronary vessels and resis- CHRONICMECHANISMS.Repeatedincreasesinbloodflow tance vessels (92). by multiple exercise bouts have been shown to lead to D Cellular mechanisms. Physical inactivity decreases an enhanced capacity to produce NO in endothelial o w NOproductionbylessshearstressandthuslowerNO cells and to structural enlargements of blood vessels. n lo synthase (NOS) expression (26). Studies that used ex- Multiple daily bouts of exercise in sedentary dogs in- a d ercisetorecoverfromsedentaryconditionshaveshown creased the expression of eNOS mRNA in the blood e d a progressive series of adaptations initiated by NO vesselwall(215).DelpandLaughlin(51)reportedthat fro (170). NO produces vasodilation and initiates enlarge- the expression of eNOS protein in the aortas of seden- m ment of the vessel circumference, although the latter taryratswasincreasedafterexercisetraining.After8 o n alteration is not apparent until after numerous daily wk of aerobic training, venous plasma NO (nitrate/ F e bouts of exercise. nitrate) was increased, whereas endothelin-1 de- b ru ACUTE MECHANISMS. The first bout of exercise by a creased in human subjects (162). a sedentary individual increases blood flow past endo- As the duration of training is continued, NO signals ry 4 thelial cells in vessels, which, in turn, increases endo- enlargements in the circumference of vascular struc- , 2 thelial cell NOS (eNOS) protein activity, ultimately tures (128). The increased vessel diameter is then 0 1 increasing its product NO. Exercise-induced vasodila- thought to minimize homeostatic disruption. The larger 5 tion is hypothesized to be mediated, in part, by shear diameter vessel would better accommodate the increase stress (44) because, when endothelial cells were ex- in exercise-induced blood flow, thus lessening the re- posed to increased fluid flow in culture, NOS mRNA sultant velocity of flow and lessening shear stress, increased (190). The increased concentration of NO whichwoulddampentheflow-stress-enhancedrelease enhancesvasodilation,whichthenlessenstheincrease of NO and its vasodilator response. Kingwell et al. in shear stress (same flow in a larger diameter vessel) (131)suggestedthattheenhancedendothelium-depen- acrossanendothelialcell.Severalfindingssupportthis dent vasodilator reserve that develops with training sequence. The NOS inhibitor L-NAME increases vas- overmonthsismostlikelyrelatedtolipidprofilemod- cularimpedanceinrats(112),whereasorganicnitrates ification,whichisparticularlyimportantinthesetting that increase NO improve arterial wall viscoelasticity of coronary and peripheral vascular disease. in miniature pigs (10), which Kingwell (128) inter- In addition to synthesizing NO, all NOS isoforms preted to mean that NO reduces arterial stiffness. catalyze superoxide anion (O(cid:5)(cid:1)) formation (265). Reac- 2 Kingwell speculated that the most likely exercise-in- tive oxygen species, such as O(cid:5)(cid:1) and H O , cause oxi- 2 2 2 duced mechanism involves NO-induced vasodilation, dative stress in endothelial cells, a condition impli- which in the physiological pressure range transfers cated in the pathogenesis of many cardiovascular and wall stress from the stiffer collagen fibers to the more pulmonary diseases. The generation of free radicals in distensible elastin matrix. In support of Kingwell’s thevesselwallfromanumberofmechanismsdegrades hypothesis,large-arterycomplianceisincreasedimme- NO and thus impairs endothelial function (132). The diately after an acute exercise bout (129). Moderate production of O(cid:5)(cid:1) decreases the levels of NO(cid:1), as these 2 aerobic exercise has been shown to increase large- molecules undergo an extremely rapid diffusion-lim- artery compliance after 4 wk in young normotensive itedradical/radicalreaction,leadingtotheformation but previously sedentary subjects (30). However, the of nitrite, nitrate, and, very importantly, the per- molecular link by which NO signals a decrease in oxynitrite anion (ONOO(cid:5)), which is highly reactive JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org 10 INVITEDREVIEW with various biological molecules (18). Alteration of CHF benefit greatly from participating in exercise- NOS activity in favor of O(cid:5)(cid:1) formation is thought to training programs. For example, exercise training of 2 underlie some pathophysiological events involving patients with moderate to severe CHF lowered all- endothelialdysfunction,e.g.,diabetes,atherosclerosis, causemortalityby63%andreducedhospitalreadmis- and aging (152). sion for heart failure by 71% (19). Therefore, physical Antioxidant enzymes, SOD (converting O(cid:5)(cid:1) into inactivity can directly or indirectly account for the 2 H O ), and catalase (converting H O into water) aug- development of a significant percentage of cases of 2 2 2 2 ment antioxidant defenses in the endothelium. Physi- CHF and also exacerbate conditions associated with cal inactivity lowers extracellular cell (ec) SOD levels, previously diagnosed CHF patients. which enhances the potential of oxidants to degrade Intermediatemechanisms.Althoughtheprimaryde- the exercise-induced increases in NO. The mechanism fective organ in CHF is the heart, the peripheral mus- is related to the lower NO production from the low culaturebecomesasecondarydefectiveorganofmajor bloodflowsandlowshearstresses.Exercisetrainingof clinical significance in that skeletal muscle limits ex- sedentary mice increases antioxidant enzymes, whose ercise tolerance. Further skeletal muscle dysfunction outcomewouldbeincreasedNObecauseofantioxidant in CHF improves with exercise training, whereas the enzymes protecting NO from degradation and vasodi- function of the primary defect, the heart, remains un- lation (from the greater amounts of NO). Three weeks affectedbytraining.Intheheartfailuresyndrome,two of treadmill training increased eNOS protein expres- of the main symptoms are fatigue and limitation in sion in C57BL/6 mouse aortas by 3.2 (cid:6) 0.5-fold com- exercise capacity. In many heart failure patients, an pared with the sedentary-treated group (75). In paral- inherent defect in skeletal muscle function is an oper- lelwiththis,theexpressionofecSODproteinwasalso ative rather than a hemodynamic limitation (234). increased by 2.8 (cid:6) 0.4-fold, whereas aortic Cu/ZnSOD CHF is a multifactorial condition that occurs because protein levels were not changed by training (75). In oftheonsetofmanyofthedescribedconditionswithin striking contrast to these results, in wild-type mice, this review. For example, coronary artery disease ac- D exercisetraininghadnoeffectonecSODproteinlevels counts for nearly 60% of cases of CHF (97). The mech- ow ineNOS(cid:5)/(cid:5)mice(75).Fukaietal.(75)interpretedthe anisms by which inactivity can mediate its effects on n lo outcomeoftheseexperimentstomeanthattheupregu- coronary artery disease have been described above. a d lation of ecSOD in response to NO(cid:1) in normal mice Physical inactivity also increases the risk of other ed would reduce reactions of NO(cid:1) with O2(cid:5)(cid:1), thereby en- chronichealthconditionsthatcanleadtoCHF.There- fro hancing the biological effects of NO(cid:1) released by the fore, it is likely that many of the cellular mechanisms m endothelium. Fukai et al. further stated that the up- that contribute to the development of these above- on regulation of ecSOD expression by NO(cid:1) very likely mentioneddiseasesduringphysicalinactivitymayalso F e represented an important feed-forward mechanism, contribute to the development of CHF. Therefore, we b whereby NO(cid:1) released from the endothelium ulti- willdescribehowexercisemayimprovethefunctionof rua mately enhanced its own biological effect by reducing those inflicted with CHF rather than reiterating how ry 4 O2(cid:5)(cid:1)inthiscriticalextracellularsite.Whereasashorter inactivity increases the risk of developing conditions , 2 trainingdurationdidnotincreaseSOD(75),16–20wk thatultimatelycontributetothedevelopmentofCHF. 01 of physical training selectively increased the levels of Cellularevidencethatexercisemayimprovetheover- 5 SOD-1 mRNA, protein, and enzymatic activity in por- all function in CHF patients. Bed rest and exercise cinecoronaryarterioles(213).Thusphysicalinactivity restriction lead to deconditioning and increased mor- is associated with lowered expression of both eNOS bidityinpatientswithsymptomaticheartfailure(234). and ecSOD, less vasodilation, higher oxidative stress, Conversely, the evidence is quite clear that exercise and more endothelial dysfunction (75). improves the overall function and exercise capacity of people inflicted with CHF. It appears that the reduc- tions in exercise capacity in CHF are not solely due to Heart Disease: Congestive Heart Failure alterations in myocardial function (251). For example, Evidence that inactivity increases incidence. The in- variousindicatorsofcardiacfunction(i.e.,ejectionfrac- cidence and mortality rate of congestive heart failure tion) do not correlate well (r (cid:7) (cid:5)0.06) with overall (CHF) have been steadily increasing over the past 10 exercisecapacityinCHFpatients(72).However,exer- years. Approximately 4.6 million individuals in the cise capacity does correlate well with measures of pe- UnitedStateshaveadiagnosisofCHF,with(cid:3)400,000 ripheral muscular strength and endurance (r (cid:7) 0.90), new cases occurring and 43,000 individuals dying an- which suggests that alterations in the periphery nually (6). Hospitalizations from CHF increased from greatly contribute to exercise intolerance in CHF pa- 377,000in1979to870,000in1996(6).Lackofphysical tients (177). This lends reasoning that, if one is to activityisconsideredanindependentriskfactorforthe improve the overall functional capacity of the CHF development of CHF (97). In addition, other primary patient, then it is necessary to attenuate the cellular risk factors include obesity, hypertension, and diabe- alterationsthatareoccurringintheperipherybecause tes. According to He et al. (97), physical inactivity can of CHF. Furthermore, results from chronic heart fail- account for 9.2% of all cases of CHF, whereas hyper- ure studies do not demonstrate improvements in left tension can account for 10.2%, diabetes for 3.2%, and ventricular performance or central hemodynamics af- obesityfor8.0%.Furthermore,patientsdiagnosedwith ter exercise training, although the patients exhibit JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org INVITEDREVIEW 11 significant improvements in overall exercise capacity inhibitor(102),suggestingaroleforNO.Therewasan (27). Therefore, it is likely that the reduction in exer- inverse relationship between change in ratio of total cise capacity in CHF patients is due to a peripheral cholesterol to HDL cholesterol and the increase in limitation, and the utilization of exercise in CHF pa- maximal forearm blood flow response to acetylcholine tients appears to improve overall exercise capacity afterthe12-wktraininginthesehypertensivepatients through the alteration of peripheral mechanisms (27). (102),suggestingaroleofhighcholesterolonendothe- Sullivan et al. (232) showed that 4–6 mo of aerobic lial dysfunction. training increased exercise capacity and improved Sedentary, spontaneously hypertensive rats had bloodflowtotheperipheralmusculature.Thedataalso greater blood pressures, a higher dose-response curve suggestthattherewerechangesinmusclemetabolism for norepinephrine, and a decreased vasodilator re- thatoccurredaftertheexerciseprogram,inthatthere sponse to acetylcholine in isolated intact aortic and seemed to be less of a reliance on glycolytic metabo- mesenteric rings compared with exercise-trained hy- lism. Furthermore, Hambrecht et al. (91) demon- pertensiverats(268).Sedentaryhypertensiveratshad strated that endurance training clearly improved the increased adrenergic agent-induced vasoconstricting peakoxygenconsumptionofCHFpatients.Hambrecht responses, associated with attenuated NO release, of et al. (91) also demonstrated that patients with CHF thoracicaortasandcarotidarteriesrelativetoexercise- exhibited multiple cellular changes in the skeletal trained hypertensive rats (37). Plasma nitrate (an in- muscle and that many of them could have contributed dex of NO quantity) was lower in sedentary hyperten- to the reductions in exercise capacity. For example, sive rats compared with those allowed access to 35 their study showed that the exercise training in the days of voluntary wheel running (120). This effect CHFpatientsproduceda“reshift”infiber-typepropor- remained for 36 h, but exercised rats returned to sed- tions from fast to slow and also indicated training entary levels by the 7th day of detraining. induced improvements in mitochondrial function (91). Cellularmechanisms.Presently,littleinformationis Therefore, there are known cellular adaptations that available describing cellular mechanisms. D occur during exercise training in CHF patients that ow lead to overall improvements in functional capacity. Stroke nlo One of the hallmark signs of CHF is a rapid devel- a d opmentofskeletalmusclefatigue(160).Alterationsin Evidencethatinactivityincreasesincidence.Physical ed excitation-contraction coupling (ECC) of skeletal mus- inactivity increases the risk of stroke (81). At least 22 fro cle are known to contribute to the development of publications report that regular exercise reduces the m skeletal muscle fatigue in healthy individuals (254, risk of ischemic stroke in men and women (Ref. 115 on 258).However,ithasbeenshownthatchangesinECC and see Ref. 146 for references). A statement for F e occur in animals that are inflicted with CHF while at healthcareprofessionalsfromtheStrokeCouncilofthe b rest, indicating that alterations in ECC could contrib- American Heart Association (81) made the recommen- rua ute to the rapid development of fatigue in CHF pa- dationthat,asperguidelinesendorsedbytheCenters ry 4 tients. Indeed, multiple studies have found that the for Disease Control and Prevention and the National , 2 functionandexpressionofvariousproteinsinvolvedin InstitutesofHealth,regularexercise((cid:2)30minofmod- 01 skeletal muscle ECC are altered in CHF (199). Re- erate-intensity activity daily) is part of a healthy life- 5 cently,Spangenburgetal.(225)describedthatexercise styleandhelpstoreducecomorbidconditionsthatmay trainingmayactuallynormalizethesechangesinECC lead to stroke. The effect of physical activity’s preven- and,therefore,allowforattenuationoftheearlyonset tion of stroke seems more convincing for ischemic of muscle fatigue. Therefore, it is apparent that exer- stroke than for hemorrhagic stroke (3, 115). cisemayimprovetheconditionofpeopleinflictedwith Intermediate mechanisms. It has been suggested CHF, whereas physical inactivity may actually be a that the protective effect of physical activity may be determinate to the mortality of CHF patients. partly mediated through its effects on various risk factors for stroke (85). Physical activity lowers blood pressure, increases HDL cholesterol concentration, is Hypertension associated with reductions in plasma fibrinogen level Evidence that inactivity increases incidence. From a and platelet aggregation, and elevates plasma tissue meta-analysisof44randomizedtrialsofphysicaltrain- plasminogen activator activity (85). Physical activity ing, it was concluded that sedentary populations had also facilitates weight loss and weight maintenance blood pressures that were higher by 2/3 (systolic/dia- (126). Convincing epidemiological data demonstrate stolic) mmHg in normotensive subjects and by 7/6 that the beneficial effects of physical activity on the (systolic/diastolic) mmHg in hypertensive patients risk of Type 2 diabetes is an important risk factor for compared with the physically active groups (62). stroke (113). Intermediate mechanisms. Patients with mild un- Cellularmechanisms.Endothelialdysfunctionines- treated essential hypertension who briskly walked for sential hypertension is due to a selective abnormality 30 min five to seven times per week for 12 wk lowered of NO synthesis, probably related to a defect in the their systolic and diastolic blood pressures and had phosphatidylinositol/Ca2(cid:8)signalingpathway(31).NO, increased forearm blood flow in response to acetylcho- apotentvasodilator,isproducedbytheendotheliumof line infusion, whose increase was blocked by a NO cerebral arteriolar resistance vessels and is crucial to JApplPhysiol(cid:127)VOL93(cid:127)JULY2002(cid:127)www.jap.org
Description: