M S AMMALIAN PECIES 44(891):16–25 Leopardus braccatus (Carnivora: Felidae) ANITA L. BARSTOW AND DAVID M. LESLIE, JR. United States Fish and Wildlife Service, Oklahoma Ecological Services Field Office, 9014 East 21st Street, Tulsa, OK 74129, USA; [email protected] (ALB) UnitedStatesGeologicalSurvey,OklahomaCooperativeFishandWildlifeResearchUnitandDepartmentofNaturalResource Ecology and Management, Oklahoma State University, Stillwater, OK 74078-3051, USA; [email protected] (DML) Abstract: Leopardusbraccatus(Cope,1889)isasmallfelid—notmuchlargerthanadomestichousecat—commonlycalledthe Pantanalcat.NocomprehensivesurveyshavebeenconductedtodeterminehowmanyL.braccatusexistinthewild.Itisfound inhumid,warmgrasslandsandwoodedareasofextremenorthwesternArgentina,southwesternandsouth-andnorth-central (newlyreportedranges)Brazil,Paraguay,andUruguay.Habitatlossanddegradationareconsideredmajorthreatsthroughout most of its range. It is uncommon in captivity and museum collections, listed with all Felidae under Appendix II of the ConventiononInternationalTradeinEndangeredSpeciesofWildFaunaandFlora,andconsidered‘‘NearThreatened’’bythe InternationalUnionforConservationofNatureandNaturalResourcesinthepampascatgroup(5L.colocolo). Key words: Argentina, Brazil, Lynchailurus, ocelot lineage, Oncifelis, pampas cat, Pantanal cat, Paraguay, Uruguay E 9 April 2012 American Society of Mammalogists Synonymies completed 16 January 2012 DOI: 10.1644/891.1 www.mammalogy.org Leopardus Gray, 1842 FelisLinnaeus,1758:41.Part(FelispardalisLinnaeus,1758). Leopardus Forska˚l, 1775:V. Nomen nudum. Puma Jardine, 1834:266. Part (Puma pajeros: Jardine, 1834 [5 Felis pajeros Desmarest, 1816]). Leopardus Gray, 1842:260. Type species Leopardus griseus Gray, 1842 (5 Felis pardalis Linnaeus, 1758), by subsequent designation (Pocock 1917:344, footnote). NoctifelisI.GeoffroySaint-Hilaire1844:37.Nomennudum; not ‘‘Felisa` pupille variable’’ (vide Kretzoiand Kretzoi 2000:257). Onco¨ıdes Severtzov, 1858:386. Type species Felis pardalis Linnaeus, 1758, by subsequent designation (Allen 1905:179);proposedasasubgenusofFelisLinnaeus,1758. Dendrailurus Severtzov, 1858:386. Type species Felis strigi- lata Wagner, 1841, by monotypy; proposed as a subgenus of Felis Linnaeus, 1758. Oncifelis Severtzov, 1858:386. Type species Felis geoffroyi d’Orbigny and Gervais, 1844, by monotypy; proposed as a subgenus of Felis Linnaeus, 1758. R Fig. 1.—Leopardus braccatus munoai exhibited as gato palheiro (5 Leoparduscolocolo)atZoolo´gicodelSa˜oPaulo.PhotographbyMa´cia Motta,copyright2004,availableattheTreeofLifeWebProject2010 (http://tolweb.org/onlinecontributors/app?page5ViewImageData& service5external&sp529125, accessed 18 January 2012). 44(891)—Leopardusbraccatus MAMMALIANSPECIES 17 Noctifelis Severtzov, 1858:386. Type species Felis guigna within this genusarecontroversialand currentlyin flux(see Molina, 1782, by monotypy; proposed as a subgenus of species’ ‘‘Context and Content’’ for relationships as they Felis Linnaeus, 1758. pertain to this species). We have chosen to follow Wozen- Lynchailurus Severtzov, 1858:386. Type species Felis pajeros craft (2005), who listed 9 species (braccatus, colocolo, Desmarest,1816,bymonotypy;proposedasasubgenus geoffroyi, guigna, jacobitus, pajeros, pardalis, tigrinus, and of Felis Linnaeus, 1758. wiedii) under Leopardus. Pardalina Gray, 1867:266. Type species Pardalina warwickii Gray, 1867 (5 Felis geoffroyi d’Orbigny and Gervais, Leopardus braccatus (Cope, 1889) 1844), by monotypy. Pantanal Cat Pajeros Gray, 1867:269. Type species Pajeros pampanus Gray, 1867 (5 Felis pajeros Desmarest, 1816), by Felis braccata Cope, 1889:144. Type locality ‘‘province of monotypy. Rio Grande do Sul, or in Matto Grosso,’’ Brazil; Pardalis Gray, 1867:270. Type species Felis pardalis Lin- restricted to ‘‘Chapada, Matto Grosso’’ by J. A. Allen naeus, 1758, by absolute tautonomy (Allen, 1919a); (1919b:378). proposed as subgenus of Felis Linnaeus, 1758. Lynchailurus pajeros braccatus: J. A. Allen, 1919b:376. Margay Gray, 1867:271. Type species Felis macroura Name combination. Wied-Neuwied, 1823 (5 Felis wiedii Schinz, 1821), by Felis (Mungofelis) braccatus: Antonius 1933:13. Name subsequent designation (Allen 1916b:580, footnote); combination. proposed as subgenus of Felis Linnaeus, 1758. Lynchailurus colocolus braccatus: Cabrera 1940:12. Name Panthera: Fitzinger, 1869:246, 253, 270, 276. Part (Panthera combination. tigrinus: Fitzinger, 1869:246 [5 Felis tigrinus Schreber, Felis colocola mun˜oai Ximenez, 1961:1. Type locality 1775]; Panthera pardalis: Fitzinger, 1869:253 [5 Felis ‘‘Uruguay.’’ pardalis Linnaeus, 1758]); Panthera geoffroyi: Fitzinger, Leopardus braccatus: Wozencraft, 2005:537. First use of 1869:270 [5 Felis geoffroyi d’Orbigny and Gervais, current name combination. 1844]); and Panthera pajeros: Fitzinger, 1869 [5 Felis pajeros Desmarest, 1816]). CONTEXT AND CONTENT. Context as for genus. Taxonomy Herpailurus: Pocock, 1917:346. Part (Felis geoffroyi d’Or- of South American small felids has been in flux for at least bigny and Gervais, 1844). the past several decades. They have been classified under OncillaJ.A.Allen,1919b:358.TypespeciesFelispardinoides various genera (e.g., Felis, Leopardus, Lynchailurus, and oncilla O. Thomas, 1903, by original designation. Oncifelis) and have been split into separate species (e.g., Mungofelis Antonius, 1933:13. Type species Felis braccata Garcia-Perea 1994; Wozencraft 2005), often monotypically, Cope, 1889, by monotypy; proposed as a subgenus of or lumped with various combinations of subspecies (e.g., Felis Linnaeus, 1758. Sunquist and Sunquist 2002, 2009). Relatively recent Oreailurus Cabrera, 1940:16. Type species Felis jacobita molecular evidence (Coss´ıos et al. 2007, 2009; Johnson et Cornalia, 1865, by original designation. al. 1996, 1999, 2006; Johnson and O’Brien 1997; Masuda et Pseudolynx:Schwangart,1941:36.TypespeciesLynchailurus al. 1996; Mattern and McLennan 2000; O’Brien and (Pseudolynx) kriegi Schwangart, 1941, by original Johnson 2007; O’Brien and Yuhki 1999; Pecon-Slattery designation; proposed as a subgenus of Lynchailurus and O’Brien 1998) suggests a phylogeny favoring various Severtzov, 1858; preoccupied by Pseudolynx Girault, subspecific designations, in contrast to systematic conclu- 1916 (Hymenoptera). sions based on just morphological characteristics that Montifelis Schwangart, 1941:37. Type species Felis colocola suggest unique species (Garcia-Perea 1994). Molina, 1782, by original designation. Using morphological characteristics, Garcia-Perea Colocolo Pocock, 1941:269. Type species Felis colocola: (1994) assessed the taxonomy of some South American Pocock, 1941 (5Felis jacobita Cornalia,1865; not Felis small felids, formerly grouped under Felis colocolo, with colocola Molina, 1782), by original designation. 86 specimens from Argentina, Brazil, Chile, Ecuador, Severtzowicus Kretozoi and Kretozoi, 2000:375. Junior Paraguay,Peru,andUruguay,consistingof72studyskins objective synonym of Noctifelis Severtzov, 1858; pro- and 51 skulls, from 8 North American, South American, posed as a replacement name for Noctifelis Severtzov, and European collections. She grouped them under 1858 under the mistaken assumption that Noctifelis Lynchailurus into 3 species: braccatus (with the 2 subspe- SevertzovwaspreoccupiedbyNoctifelisGeoffroySaint- cies above; Fig. 1), pajeros (7 subspecies), and colocolo (2 Hilaire, 1844. subspecies). The size of the ectotympanic bone relative to caudal CONTEXT AND CONTENT. Order Carnivora, suborder Feli- entotympanic bone of Leopardus is usually consistent within formia, family Felidae, subfamily Felinae. The relationships species, but some variation in the inflation of the posterior 18 MAMMALIANSPECIES 44(891)—Leopardusbraccatus chambermaybeseenamongspecies(Garcia-Perea1994).Two GENERAL CHARACTERS to 5 distinguishing characteristics of the skulls (e.g., bullar region, orbital region, palatal region, and neurocranium) and Garcia-Perea(1994)describesallspeciesinthe‘‘pampas teeth were found among the various specimens of Leopardus, cat’’ group, including Leopardus braccatus, as follows: face designatedcollectivelyas‘‘pampascats’’(Garcia-Perea1994). has 2 transverse brown to black lines that cross each cheek; Small felids generally show a great deal of variation in coat superior line starts in the external corner of the eye; inferior patterns and colors. Considering all metrics, as well as line is almost parallel running up around the lateral side of geographic affinities, Garcia-Perea (1994) classified 3 ‘‘types’’ the cheeks; and a 3rd line appears in some specimens at the ofpampascatsandconcludedthatcolocoloshouldbesplitinto dorsal end of the inferior line coming from under the chin 3species(braccatus,colocolo,andpajeros)withwhichWozen- and throat, creating a sharp angle where the 2 meet on the craft (2005) concurred. Sunquist and Sunquist (2009:146) lateroposterior side of the cheeks. Underside of the chin is formally considered braccatus to be 1 of 8 subspecies of L. white; throat is the same color as the basic coat color, or is colocolo, but they noted that ‘‘braccatus and pajeros likely somewhat lighter orangish brown, and has 2 or 3 brown representdistinct species.’’ Most recently, Nascimento (2010), stripesthatoriginateon1sideoftheneckandrununderthe in his unpublished dissertation, identified 16 species of throat to the other side. There are reports of melanistic Leopardusbasedon29cranialmeasurementsand14additional ‘‘pampas cats’’ in captivity, but a camera-trap photo in morphologicaltraitsfrom591museumspecimens;heelevated EmasPark,Goia´sState,Brazil,seemstobetheonlyknown L. braccatus munoai to a full species. Conservation of South record in the wild (Silveira 2005). Americansmallcatsmaybethemostsignificantandpressing Thereare2typesofpelageinL.braccatus.The1sttypeis reasontoconsidertheirpopulationsuniqueenoughforspecial ‘‘almostuniformbrownagouticolordorsally’’withtracesof recognitionandaction(Johnsonetal.1999). ‘‘dark brown rosettes on flanks’’ and is characteristic of Here, we followed Wozencraft (2005), who listed 2 L. b. braccatus (Garcia-Perea 1994:19; http://www.catsg.org/ subspecies of braccatus: catsgportal/project-o-month/02_webarchive/grafics/sept2005. pdf, accessed 18 January 2012). The spinal crest of L. b. L. b. braccatus (Cope, 1889). See above. braccatus is a little darker than the basic pelage; tail is not L. b. mun˜oai Ximenez, 1961. See above. ringedbuthas2or3linesthatdonotcompletelycircumvent thetail above a black tip. There areatleast2 (but canbe as NOMENCLATURALNOTES. The etymologyofLeopardusbrac- many as 4) heavy black stripes that wrap around the front catus is Latin meaning lion–panther and wearing breeches. legs, and similar stripes on the hind legs, although those Common names of L. braccatus include Pantanal cat, gato stripes may not completely meet on the anterior part of the palheiro(Garcia-Perea1994),andbushcat(Miller1930). leg. Spotted ventral markings of L. b. braccatus are black; throat is white, grading into orange behind the 1st throat DIAGNOSIS stripe; feet are black dorsally and ventrally, including wrists andankles,givingthedistinctiveappearanceofwearingboots The ectotympanic bone of Leopardus braccatus lacks (Allen1919b;Garcia-Perea1994;Miller1930;Pocock1941). significantposteroventralexpansionorinflationandrepresents The 2nd pelage type, typical of L. b. munoai, has a only20–25%ofthebullarvolume,incontrasttothecolocolo, background color that is paler and more yellow to orangish L. colocolo (40–50%), and the pampas cat, L. pajeros (25– on the back and flanks (Fig. 1). Brown spots on flanks are 35%—Garcia-Perea 1994). Shape of the notch for the morenoticeablethaninL.b.braccatus,andthefeetareblack postpalatine vein in the palate is ‘‘narrow and deep’’ in only on palmar and plantar surfaces. The tail of both L. braccatus and ‘‘wide and comparatively shallow’’ in subspecies is variously tipped in black. In contrast to L. b. L. colocolo and L. pajeros (Garcia-Perea 1994:11). The braccatus,theblacktipofL.b.munoaiisreduced,andthetail frequency of the presence of P2 is higher in L. braccatus itselfhasonlyafewdiscontinuousrings(Garcia-Perea1994). (63%, n 5 8)than in L. colocolo (33%, n 5 6) and L. pajeros Ears of Leopardus are large and pointed rather than (0%, n 5 21). Shape of the main cusp (paracone) of rounded as in other South American small felids (Silveira L. braccatus is ‘‘short and wide in lateral aspect, lacking the 1995); they are usually black on the anterior one-half and sharpappearance’’seeninL.colocoloandL.pajeros(Garcia- grayontherestofthesurface(Silveira1995);andsometimes Perea1994:15).Theanteriorcusp(parastyle)ofP3tendstobe thereisapalespottowardthetipoftheposteriorsurfaceof absent in all felids except big cats (Salles 1992); however, the ear. The hairs are longer on L. braccatus than on other Gracia-Perea(1994)noteditspresencein3specimensthatshe South American species ofLeopardus.Head–bodylength of classified as L. braccatus and its absence in L. colocolo and Leopardus, in general, is 423–750 mm; tail length is 220– L. pajeros. Lingual tubercles on c1 occur with the highest 330mm;andmassis2.9–3.7kg(Garcia-Perea1994;Nowell frequency in L. braccatus and at very low frequency in and Jackson 1996; Redford and Eisenberg 1992; Silveria L.pajeros;theyareabsentinL.colocolo(Garcia-Perea1994). 1995; Sunquist and Sunquist 2002). 44(891)—Leopardusbraccatus MAMMALIANSPECIES 19 Garcia-Perea 1994; Nowell and Jackson 1996; Redford and Eisenberg 1992; Sunquist and Sunquist 2009; Ximenez 1961). Because of its extensive range, L. b. braccatus occurs in many more habitat types than L. b. munoai. A cat matching Garcia-Perea’s (1994) description of L. b. braccatus was livetrappedinMinasGerais,Brazil,exceptthefeetwereonly blackonthepalmarandplantarsurfacesinsteadofhavingthe characteristicbootpattern.TheWildCatsofBrazilProject,or ProjetoGatosdeMato–Brasil(deOliveira2005,2006;http:// www.wildcatconservation.org/Wild-Cats-of-Brazil.html, ac- cessed 26 September 2011) also found camera-trap evidence of L. b. braccatus from Maranha˜o State of northern Brazil; Sa´nchez-Soto(2007)recordedaroad-killedspecimeninMato GrossodoSul,Brazil;andChebezetal.(2008)documentedits presenceinArgentina—allgreatlyexpandingtheknownrange of this subspecies (Bagno et al. 2004; Chebez et al. 2008; de Oliveira2006;Garcia-Perea1994;Sa´nchez-Soto2007;Silveira 2005). Therefore, the approximate range of L. b.braccatus is between 2uS and 22uS and 45uW and 61uW (Fig. 2). L. b. munoai occurs only in Uruguay and the state of Rio Grande doSul,Brazil.Itsprimaryhabitatissavannathatoccursfrom sea level to 514 m above mean sea level (Bagno et al. 2004; Chebezetal.2008;deOliveira2006;Garcia-Perea1994). FOSSIL RECORD TheformationofthePanamanianlandbridgepermitted Fig. 2.—Known distribution of 1, Leopardus braccatus braccatus and2,L.b.munoaiindarkgreen(Garcia-Perea1994)andthelikely endemic small felids of North and Central America to expanded range of the species in lighter green, based on recent disperse extensively into South America (Eizirik et al. 1998; observations (Bagno et al. 2004; Chebez et al. 2008; de Oliveira Johnsonetal.1996;JohnsonandO’Brien1997;O’Brienand 2006; Sa´nchez-Soto2007; Silveira 2005). Yuhki 1999; Pecon-Slattery et al. 1994; Seidensticker and Lumpkin 2004; Wayne et al. 1989). The land bridge was completely established about 3 million years ago (Coates A dorsal crest is distinctive of the pampas cat group, in and Obando 1996), but sea-level changes interrupted its whichhairsarelonger(7cm)thanelsewhereonthebodyand formationseveraltimesuntilthemid-Pleistocene(Beu2001), flanks(1–3cm—Allen1919b;NowellandJackson1996).The suggesting that felid speciation also occurred in South crestisabout3cmwideandrunsfromthebackoftheneckto America and recent diversity could be explained by a the base of the tail; it is reduced in some specimens of L. minimum of 5 or 6 immigrations (Prevosti 2006). braccatus, makingit ratherinconspicuous (Courtenay2002). Nine of the 10 Neotropical small felids are in a Both (nonmelanistic) pelage types have 3 or 4 dark brown, monophyletic group known as the ocelot lineage (Collier almostblack,stripesthatcircumventthelegs,buttheymaybe and O’Brien 1985; Eizirik et al. 1998; Johnson et al. 1999; incompleteontheinnersideofthebacklegs. Mattern and McLennan 2000; Pecon-Slattery et al. 1994; Salles 1992). The fossil record of the ocelot lineage is very DISTRIBUTION fragmentary, but specimens are known from the Ensenadan Age 2–0.5 million years ago (Berta 1983; Prevosti 2006). Leopardus braccatus inhabits humid, wet, and warm ‘‘Felis’’ vorohuensi from Buenos Aires Province, Argentina, grasslandsandforestsofmoderateelevationincentralSouth was described by Berta (1983) and considered Plio– America (Garcia-Perea 1994; Seidensticker and Lumpkin Pleistocene in age. Prevosti (2006) restricted the age of this 2004). Two geographically disjunct populations are known fossil to 0.78–0.5 million years ago after reexamination of to occur east of the Andes (Fig. 2): 1 population in Brazil, biostratigraphic and chronostratigraphic data from the Paraguay, and extreme northeastern Argentina (L. b. locality. braccatus) and the other population in Uruguay and Rio The oldest fossils of Leopardus colocolo are from late Grande do Sul, Brazil (L. b. munoai—Ca´ceres et al. 2008; Ensenadan (0.78–0.5 million years ago) and Bonaerian– 20 MAMMALIANSPECIES 44(891)—Leopardusbraccatus limited,butinthe2populationsthatGarcia-Perea(1994:table 4)classifiedasbraccatus,ranges(mm)were:greatestlengthof skull,94.3–100.5(4males);condylobasallength,89.4–91.8(4 males); rostralwidth acrossthecanines,21.6–24.1 (4males); mastoidalwidth,39.2–42.9(4males);interorbitalwidth,17.2– 18.3 (4 males); postorbital width, 27.4–29.7 (3 males); zygomatic width, 62.1–67.5 (4 males and 1 female); length of P4 at the cingulum, 11–13 (4 males and 1 female); and mandibular length, 58.8–63.8 (4 males and 1 female). Dentitionreflectsthehighlypredatorylifestyleofanobligate carnivore.ThedentalformulaofL.braccatusisi3/3,c1/1,p 3/2,m1/1,total30(Garcia-Perea1994;Nowak1991). ECOLOGY Population characteristics.—There has been limited research on the ecology of Leopardus braccatus, so aspects ofitsecologyandbehaviorareinferredherefromreportson the ‘‘pampas cat’’ group in general (Bagno et al. 2004; Fig. 3.—Lateral views of skull (top) and mandible (bottom) and Chebez et al. 2008; Coss´ıos et al. 2007, 2009; Eizirik et al. brokenpieceofpremaxillae–nasalandpartialorbit(inset)ofmale 1998; Garcia-Perea 1994; Johnson and O’Brien 1997; Leopardus braccatus; United States National Museum of Natural Johnson et al. 1999; Masuda et al. 1996; Mattern and History, specimen 256127, labeled Oncifelis colocolo braccata, McLennan 2000; Napolitano et al. 2008; Nowell and locality ‘‘Brazil: Mato Grosso, Descalvados, Upper Paraguay Jackson 1996; O’Brien and Yuhki 1999; Pecon-Slattery et River,’’ collected by F. W. Miller, 29 November 1925 (see al. 1994, 2000, 2004; Pecon-Slattery and O’Brien 1998; Miller 1930). Silveira 2005). Longevity ranges from an average of 9 years inthewildupto16.5yearsincaptivity(NowellandJackson Lujanian (0.5 million–8.5 thousand years ago) localities in 1996). Litter size is 1–3 kittens, and a captive female gave thePampeanregionofArgentina(Prevosti2006).Afossilof birth at 24 months of age (Nowell and Jackson 1996; L. colocolo also was found in Tierra del Fuego, Chile, an Redford and Eisenberg 1992). Gestation is 80–85 days islandnotcurrentlyinhabitedbyfelids,andthoughttobeas (Golden 2003). young as the late Pleistocene or early Holocene (Prevosti Space use.—Home-range size of Leopardus braccatus 2006). L. colocolo split from the common ocelot ancestor was 3.07–36.98 km2 (SD 5 23.33 km2) in Brazilian about 1.7 million years ago, based on molecular estimates grasslands (Silveira 2005). Individual pampas cats appeared (Johnson et al. 1999). A fossilized left humerus identified to be diurnal with some crepuscular and only occasional as L. braccatus from the late Pleistocene–early Holocene nocturnalactivity(CabreraandYepes1960).Radiotracking recentlywasfoundinSerradaBodoquena,MatoGrossodo studies by Silveira (2005:4) found ‘‘virtually no activity Sul, Brazil, near the type locality (Perini et al. 2009). duringnighttime.’’VocalizationsofL.braccatusaresimilar to other small felids and include meow, growl, spit, hiss, FORM AND FUNCTION gurgle, and purr (Sunquist and Sunquist 2002). Leopardus braccatus is known to occur in many biomes Leopardus braccatus has retractable claws that are large, in South America including the Pantanal, Chaco, Pampas, compressed, sharp, and strongly curved (Nowak 1991) and Cerrado,Espinal,Monte,deciduousforests,andtransitional digitigradeadaptationsofthefeet(Flynnetal.1988).Except areas, all found in Argentina, Brazil, Paraguay, and for the pads, hairs occur on the feet that allow it to silently Uruguay. These habitats are being rapidly converted from stalkprey(Nowak1991).Earsarelargeinrelationshiptohead native vegetation to cattle ranching and agricultural fields, andforwardfacing,buttheycanberotatedslightly.Eyesface and severe fragmentation by roads and urban sprawl are forwardwithbinocularvisionforsharpvisualacuity(Flynnet growing problems throughout the range of L. braccatus al.1988);pupilsoftheeyesadductcreatingaverticalslit.The (Bagno et al. 2004; Cavalcanti and Gese 2009; Soisalo and tongue is covered with sharp-pointed, backward-facing, Cavalcanti 2006; Trolle 2003). L. braccatus is reportedly calcified papillae (Flynn et al. 1988) used for lacerating and foundinpasturesandagriculturalfields,demonstratingthat retainingfoodwithinthemouthandforgrooming. it can use human-altered habitats (Bagno et al. 2004) and The skull is rounded and shortened anteriorly (Fig. 3). adapt to changing environments. Within the range of L. b. Published skull measurements of L. braccatus are very munoai in Uruguay and southern Brazil, the Paraguay and 44(891)—Leopardusbraccatus MAMMALIANSPECIES 21 Rio de la Plata river basins are believed to be barriers to Diet.—Leopardus braccatus appears to feed on ground dispersal and gene flow (Johnson et al. 1999). birds, small mammals, and guinea pigs (Cavia aperea— Leopardus braccatus occupies humid and warm grass- Nowell and Jackson 1996; Silveira 1995). Stomach contents lands and forests from sea level to 2,000 m (Garcia-Perea of 4 recent road-killed individuals contained small lizards 1994; Johnson et al. 1999). Annual rainfall varies within andacolubridsnake(Colubridae)—the1strecordofreptiles the range of L. braccatus because it occurs in a wide variety inthediet ofL.braccatus.Plantmaterial, some beetles,and of ecotypes: Chaco (dry forests and wet savannas), annual a small diurnal–crepuscular rodent also were found in the rainfall 450–1,200 mm (increasing from west to east), stomachs, suggesting nocturnal and diurnal activity of L. winter–summer temperatures 20–23uC; Espinal (xerophitic braccatus (Bagno et al. 2004). Diseases and parasites.—No specific diseases have been forests), annual rainfall 400–1,000 mm (increasing from reported for Leopardus braccatus, but Toxoplasma gondii, a south to north), winter–summer temperatures 15–20uC; and parasitic protozoan responsible for toxoplasmosis in hu- Monte(dryshrub–scrubsteppe),annualrainfall80–200mm, mans, was reported in a captive Oncifelis (5 Leopardus) winter–summer temperatures 13–17uC (Bagno et al. 2004). colocoloinBrazil.Littleisknownaboutwhatrolewildfelids The vegetation within the range of L. braccatus is generally have in the natural epidemiology of T. gondii, or as a cause characterized by a mix of open grasslands to dense of felid mortality or morbidity (Silva et al. 2001). Two woodlands. captive Oncifelis(5Leopardus)colocolo in North American Seasonal precipitation, soil fertility, drainage, fire zoos had active feline leukemia virus, and other captive regime, and climatic fluctuations influence development of Brazilian pampas cats tested positive for the virus (Filoni et the different vegetative stages within the range of L. al. 2003). Feline immunodeficiency virus and antibodies to braccatus (Bagno et al. 2004; de Oliveira-Filho and Ratter feline coronavirus were reported in captive Brazilian felids 2002; Trolle 2003). Along the transitional zone from including Oncifelis (5 Leopardus) colocolo (Filoni et al. grassland to woodland, various vegetative stages have been 2006).AntibodiesofBartonellahenselae(aproteobacterium) described. The stages of transition are campo limpo (clean werefoundatveryhighprevalenceinfree-rangingBrazilian field),agrasslandwithnoshrubsortrees;camposujo(dirty felids,implyingthecatsactasareservoir.B.henselaecauses field),agrasslandwithascatteringofsmalltreesandshrubs; cat scratch disease in humans; fleas and ticks in the genus campocerrado(closedfield),withtreecoverof30–90%;and Ixodes may serve as potential vectors for its transmission cerrada˜o(densewoodland),thelaststagealmostcompletely (Filoni et al. 2006). covered with large trees and sparse ground-cover layer. Ticks (Acari: Ixodida) that occur primarily on horses Leopardus braccatus gets its common name, Pantanal and cattle also occur on carnivores in areas where the cat, from the Pantanal wetland complex, a 140,000-km2 original vegetation has been replaced with cultivated floodplain of the Paran˜a–Paraguay watersheds. The Panta- pastures and are affected by other anthropogenic distur- nal is typified by a mosaic of the major biomes of central bances and fragmentation (Labruna et al. 2005). Fungal Brazil, Paraguayan Chaco, and Amazonian forest; a matrix dermatophytes that can lead to parasitic skin infections and of open fields interspersed with isolated patches of cause superficial mycoses in animals and humans have been secondary forests and gallery forests border intermittent found in asymptomatic healthy wild felids in captivity at and permanent rivers (Cavalcanti and Gese 2009). The Fundac¸a˜o Parque Zoolo´gico de Sa˜o Paulo, Brazil. Samples Pantanalisalmosttotallyinundatedduringtherainyseason were taken from 130 adult animals of both sexes, including in October–March, with mean monthly precipitation of large, medium, and small cats; specifically, 8 Oncifelis 145mm;duringthedryseasoninApril–September,itsmean (5 Leopardus) colocolo were confirmed as asymptomatic monthly precipitation is only 48 mm. Climate is seasonal, carriers and sources of potential infection for other animals with warm, wet summers and cold, dry winters; winter– and humans(Bentubo etal. 2006). Many captive small felid summer temperatures are 18–42uC (Cavalcanti and Gese species show some degree of skin disorders, traumatic 2009; Trolle 2003). lesions, enteritis, and dental disorders (Filoni et al. 2003). When the Pantanal is not seasonally flooded, many Interspecific interactions.—Leopardus braccatus is sym- small water depressions are dispersed throughout its patric with other small felids such as L. tigrinus (oncilla or grasslands or forests. L. braccatus can be found among littletigercat)andL.geoffroyi(Geoffroy’scat—Bagnoetal. clumps of tall pampas grass in Uruguay and in low-lying 2004; Hemmer 1978; Johnson et al. 1999; Silveira 2005). swampy areas (Nowel and Jackson 1996; Silveira 1995; L. braccatus hybridized with L. tigrinus in areas of range Ximenez 1961). L. braccatus has recently been found much overlap (Coss´ıos et al. 2009; Johnson et al. 1999). Jaguars farther north than previously recorded (de Oliveira 2005, (Panthera onca) are known to inhabit areas of the Pantanal 2006), and rates of land conversion and fragmentation of in Argentina (Soisalo and Cavalcanti 2006), and landscape- available habitat in the Pantanal are increasing (Cavalcanti levelsurveysineasternParaguayrevealedthatsmallspotted andGese2009),perhapsputtingpressureonL.braccatusto cats such as L. braccatus avoid areas where jaguars occur seek out alternative habitats. (Zuercher et al. 2001). 22 MAMMALIANSPECIES 44(891)—Leopardusbraccatus GENETICS landdegradationfromcattlegrazing,fragmentation,hunting by local farmers in retaliation for depredation of their The genus Leopardus has a reduced number of diploid chickens, and decline of prey populations (Bagno et al. chromosomes(2n536),unlikeothercatgenerathathave38 2004;Coss´ıosetal.2009;SoisaloandCavalcanti2006;Trolle chromosomepairs(CollierandO’Brien1985;Hemmer1978; 2003). Grazing in the Pantanal has been shown to have Mattern and McLennan 2000; Wayne et al. 1989). The adverseimpactsontheenvironment;morespecifically,forests unique metacentric chromosome, C3, in Leopardus results in the Pantanal are now dominated by invasive Acur´ı palms from the fusion of 2 acrocentric F-group chromosomes. (Attaleaphalerata)withlittleundergrowthandrelativelylittle Over thelast decade, O’Brien and colleagues performed woodyplantspecies(Trolle2003). genetic analyses on various aspects of the ‘‘pampas cat’’ For conservation of L. braccatus to be effective, more- genome (including but not limited to Leopardus braccatus), specific information is needed about its distribution, such as phylogenetic reconstruction, gene sequencing of population status, ecological requirements, and genetic both nuclear and mitochondrial DNA, and protein electro- diversity (Lucherini et al. 2004). Methods to monitor phoresis(Coss´ıosetal.2009;Eiziriketal.1998;Johnsonand important habitats of L. braccatus will continue to include O’Brien 1997; Johnson et al. 1999; Masuda et al. 1996; camera-trapping (Trolle 2003), because the species is recog- Mattern and McLennan 2000; Napolitano et al. 2008; nizable from its coat pattern (Lucherini et al. 2004). Studies O’Brien and Yuhki 1999; Pecon-Slattery et al. 1994, 2000, have shown genetic differences in alleles of L. braccatus and 2004; Pecon-Slattery and O’Brien 1998). Contrary to other closely related Leopardus species (Johnson et al. 1999; Wozencraft (2005) and the suggestions of Sunquist and Trigo et al. 2008), but more basic research is needed on the Sunquist (2009), those molecular studies suggested that all systematics of South American small cats in general due to species split by Garcia-Perea (1994) should be subspecies conflictingresultsfrommolecularandmorphologicalstudies under L. colocolo. Although O’Brien and colleagues (SunquistandSunquist2009). maintained confidence in the origins and blood lines of the During the Miocene, the climate of Earth changed, samples collected and subsequently used in most genetic resulting in pronounced ecological shifts in habitat charac- studies of L. colocolo (S. J. O’Brien, pers. comm., 2010), teristicsandavailability. AspartsofSouthAmerica became many of these samples were not collected from wild-caught more arid and seasonal, the shrub–grassland steppe initially individuals, but rather most samples were collected from appeared as a continuum of habitats that changed from individuals in various zoos; some with unknown histories dense forests to open expanses. Species no doubt adapted or origins. This introduces some degree of uncertainty in to these changes, but populations likely became isolated as taxonomic conclusions to date. preferredhabitatsbecamemoredisjunct.Somespecies,such GeneticstudiesbyJohnsonetal.(1999)identifiedhybrids asL.braccatus,probablystartedtoexploitnewlydeveloping inthegeneralareaofhome-rangeoverlapbetweenamaleL. shrublands and grasslands, which provided novel prey braccatus and a female L. tigrinus; the hybrids displayed the (Canepuccia et al. 2008; Hemmer 1979). tigrina pelage. Trigo et al. (2008) performed further genetic Amid current changes in global climate, precipitation investigations with an expanded data set and found more of regimeswillbecomealtered,andeffectsofhabitatchangeon the same hybridizations. One animal tested by Trigo et al. species abundance and biodiversity will be amplified, likely (2008) was believed to be a hybrid in the opposite direction increasing emigration and adversely impacting survival (mitochondrial DNA from L. tigrinus introgressed into a rates at the population level (Canepuccia et al. 2008; L.colocolo)documentingadditionalcrossbreedingwithinthe Hemmer1979).AreasinArgentinawithinthecurrentrange group; however, the origin and ‘‘race’’ of that animal was of L. braccatus have experienced an increase in annual unknown.Naturallyoccurringhybridsmaycomefromareas precipitation of 10–30% over the last 50 years (Canepuccia of distributional overlap, and such individuals may exhibit et al. 2008). L. braccatus may face greater threats in low- morphologicalproblemssuchasunusualpenilestructureand lying areas with increased precipitation, given that most lackofspermatozoainejaculate,aswasfoundin1adultmale nativeuplandshavebeenconvertedtoagriculture(asmuch hybrid(Johnsonetal.1999). as80%oftheCerrado—Bagnoetal.2004)andareusedfor grazing. These effects can adversely impact populations, CONSERVATION both directly and indirectly, by altering fitness and modifying availability of resources. Prey abundance may In Brazil and Argentina, Leopardus braccatus is consid- be reduced, and den sites may be lost to flooding. These ered ‘‘Vulnerable.’’ The International Union for Conserva- interactionssuggestthatglobalclimaticpatternscouldhave tion of Nature and Natural Resources lists the pampas cat significant negative impacts at regional and local popula- group (5 L. colocolo) as ‘‘Near Threatened’’ (Pereira et al. tion scales (Canepuccia et al. 2008). 2008) because future population declines are likely to result To foster the conservation of L. braccatus, the following from landconversionof nativehabitattoagriculturalcrops, actions might be beneficial: reduce loss of native habitat to 44(891)—Leopardusbraccatus MAMMALIANSPECIES 23 agriculture; identify populations and metapopulations of L. predatorstorainfall-inducedhabitatlossandsubsequentvariations inpreyavailability.CanadianJournalofZoology86:407–418. braccatus across its entire range; create conservation areas to CAVALCANTI, S. M. C., AND E. M. GESE. 2009. Spatial ecology and minimizefurtherhabitatlossandpublicoutreachprogramsto social interactions of jaguars (Panthera onca) in the southern educate people about the species and its needs; and generally Pantanal,Brazil.JournalofMammalogy90:935–945. increaseawarenessofthevulnerabilityofallspeciesinthispart CHEBEZ, J. C., N. A. NIGRO, G. A. SOLI´S, AND A. T. STRUMIA. 2008. Confirmacio´n de la presencia del gato del Pantanal Lynchailurus ofSouthAmerica.Furthermore,additionalgeneticresearchon braccatus (Cope, 1889) en la Argentina. No´tulas Faun´ısticas— wild-caught individuals could help validate or refute earlier SegundaSerie19:1–11. geneticresearchperformedonlargelycaptiveanimals. COATES,A.G.,ANDJ.A.OBANDO.1996.Thegeologicevidenceofthe Central American Isthmus. Pp. 21–56 in Evolution and environ- mentintropicalAmerica(B.C.Jackson,A.F.Budd,andA.G. ACKNOWLEDGMENTS Coates,eds.).UniversityofChicagoPress,Chicago,Illinois. COLLIER,G.E.,ANDS.J.O’BRIEN.1985.Amolecularphylogenyofthe Felidae:immunologicaldistance.Evolution39:437–487. We thank C. A. Davis, J. H. Shaw, and Z. Roehrs for COPE, E. D. 1889. On the mammalia obtained by the Naturalist reviewing drafts of this account and J. P. Jorgenson, Exploring Expedition to southern Brazil. American Naturalist Division of Scientific Authority, United States Fish and 23(266):128–150. Wildlife Service, for help with establishing contacts with CORNALIA,E. 1865. Descrizionedi una nuova specie del genere: Felis. Felis jacobita (Corn.). Memorie della Societa´ Italiana di Scienze felid researchers in South America. T. de Oliveira provided Naturalli1:1–10. support and encouragement for this effort. Logistical and COSSI´OS, D., M. LUCHERINI, M. RUIZ-GARC´IA, AND B. ANGERS. 2009. financial support was provided by the United States Fish InfluenceofancientglacialperiodsontheAndeanfauna:thecaseof and Wildlife Service’s Oklahoma Ecological Services Field thepampascat(Leoparduscolocolo).BMCEvolutionaryBiology9:68. Office and the Oklahoma Cooperative Fish and Wildlife COSSI´OS,D.,ETAL.2007.UpdateonthedistributionoftheAndeancat Oreailurus jacobita and the pampas cat Lynchailurus colocolo in Research Unit (Oklahoma State University, Oklahoma Peru.EndangeredSpeciesResearch3:313–320. Department of Wildlife Conservation, United States Geo- COURTENAY, O. 2002. A new record of pampas cat, Lynchailurus logical Survey, United States Fish and Wildlife Service, and braccatus,inBrazil.Mammalia66:295–297. Wildlife Management Institute, cooperating). The findings DEOLIVEIRA, T. G. 2005. Wild cats of Brazil project/Projeto gatos do mato—Brasil. Cat project of the month—July. International and conclusions in this article are those of the authors and UnionforConservationofNatureandNaturalResources/Species do not necessarily represent the views of the United States SurvivalCommission CatSpecialist Groupfeature projectofthe Fish and Wildlife Service or the United States Geological month. www.catsg.org/catsgportal/project-o-month/02_webarchive/ Survey. webarchive.htm,accessed26February2010. DEOLIVEIRA, T. G. 2006. Project wild cats of Brazil. Wild Cat News 2(2):1–8. LITERATURE CITED DE OLIVEIRA-FILHO, A. T., AND J. A. RATTER. 2002. Vegetation physiognomies and woody flora of the Cerrado biome. ALLEN,J.A.1905.ReportsofthePrincetonUniversityexpeditionsto Pp.91–420inTheCerradosofBrazil:ecologyandnaturalhistory Patagonia, 1896–1899. Vol. 3. Zoo¨logy. Part 1. Mammalia of ofaNeotropicalsavanna(P.S.OliveiraandR.J.Marquis,eds.). southern Patagonia. J. Pierpoint Morgan Fund, Princeton ColumbiaUniversityPress,NewYork. University, Princeton, New Jersey, and Schweizerbart’sche Ver- DESMAREST, A.-G. 1816. Chat, Felis, Linn., Briss., Schreb., Cuv. lagshandlung,Stuttgart,Germany. Pp.73–123inNouveaudictionnaired’historienaturelle,applique´ ALLEN,J.A.1919a.Severtzow’sclassificationoftheFelidæ.Bulletinof aux arts, a` l’agriculture, a` l’e´conomie rurale et domestique, a` la theAmericanMuseumofNaturalHistory41:335–340. medicine, etc. Par une socie´te´ de naturalists et d’agriculteurs, ALLEN,J.A.1919b.Notesonthesynonymyandnomenclatureofthe Nouv.ed.6.Deterville,Paris,France. smallerspottedcatsoftropicalAmerica.BulletinoftheAmerican D’ORBIGNY,A.,ANDP.GERVAIS.1844.Mammalogie:nouvelleespecede MuseumofNaturalHistory41:341–419. Felis.ExtraitsdesProce´sVerbauxSe´ances,Socie´te´Philomathique ANTONIUS, W. VON O. 1933. U¨ber Felis braccata Cope und andere deParis1844:40–41. Scho¨nbrunnerKleinkatzen.DerZoologischeGarten6:10–22. EIZIRIK,E.,ETAL.1998.Phylogeographicpatternsandevolutionofthe BAGNO, M. A., ET AL. 2004. Notes on the natural history and mitochondrial DNA control region in two Neotropical cats conservation status of pampas cat, Oncifelis colocolo, in the (Mammalia,Felidae).JournalofMolecularEvolution47:613–624. BrazilianCerrado.Mammalia68:75–79. FILONI,C.,C.H.ADANIA,E.L.DURIGON,ANDJ.L.CATA˜O-DIAS.2003. BENTUBO, H. D. L., ET AL. 2006. Isolation of Microsporum gypseum Serosurvey for feline leukemia virus and lentiviruses in captive fromthehaircoatofhealthywildfelidskeptincaptivityinBrazil. smallNeotropicfelidsinSa˜oPauloState,Brazil.JournalofZoo JournalofMicrobiology37:148–152. andWildlifeMedicine34:65–68. BERTA, A. 1983. A new species of small cat (Felidae) from the late FILONI,C.,ETAL.2006.Firstevidenceoffelineherpesvirus,calicivirus, Pliocene–early Pleistocene (Uquian) of Argentina. Journal of parvovirus,andEhrlichiaexposureinBrazilianfree-rangingfelids. Mammalogy64:720–725. JournalofWildlifeDiseases42:470–477. BEU,A.G.2001.GradualMiocenetoPleistoceneupliftoftheCentral FITZINGER,L.J.1869.Revisionderzurnatu¨rlichenFamiliederKatzen AmericanIsthmus:evidencefromtropicalAmericanTonnoidean (Feles) geho¨rigen Formen. Sitzungberichte der Kaiserlichen gastropods.JournalofPaleontology75:706–720. AkademiederWissenschaften59:211–279. CABRERA, A. 1940. Notas sobre carnivoros sudamericanos. Notas del FLYNN,J.E.,N.A.NEFF,ANDR.H.TEDFORD.1998.Phylogenyofthe MuseodeLaPlataZoologia5(29):1–22. Carnivora.Pp.73–116inThephylogenyandclassificationofthe CABRERA, A., AND J. YEPES. 1960. Mam´ıferos Sud-Americanos, vida, tetrapod (M. J. Benton, ed.). Vol. 2. Clarendon Press, Oxford, costumbres y descripcion. Historia Natural Ediar, Buenos Aires UnitedKingdom. 2:159–370. FORSKA˚L, P. 1775. Descriptiones animalium: avium, amphibiorum, CA´CERES, N. C., A. P. CARMIGNOTTO, E. FISCHER, AND C. F. SANTOS. piscium,insectorum,vermium;quæinitinereOrientali(postmortem 2008.MammalsfromMatoGrossodoSul,Brazil;listsofspecies. auctorisCarstenNiebuhr).Mo¨lleri,Copenhagen,Denmark. JournalofSpeciesListsandDistribution,CheckList4:321–335. GARCIA-PEREA, R. 1994. The pampas cat group (genus Lynchailurus CANEPUCCIA, A. D., A. A. FARIAS, A. H. ESCALANTE, O. IRIBARNE, A. Severtzov, 1858) (Carnivora: Felidae), a systematic and biogeo- NOVARO, AND J. P. ISACCH. 2008. Differential response of marsh graphicreview.AmericanMuseumNovitates3096:1–35. 24 MAMMALIANSPECIES 44(891)—Leopardusbraccatus GEOFFROY SAINT-HILAIRE, I. 1844. Voyages dans l’Inde par V. O’BRIEN,S.J.,ANDN.YUHKI.1999.Comparativegenomeorganization Jacquemont,pendantlesanne´es1828a` 1832. TomeVI. Part2. ofthemajorhistocompatibilitycomplex:lessonsfromtheFelidae. DidotFre`res,Paris,France. ImmunologicalReviews167:133–144. GIRAULT,A.1916.AnewgenusofEulophidaefromtheUnitedStates. PECON-SLATTERY,J.,W.E.JOHNSON,D.GOLDMAN,ANDS.J.O’BRIEN. EntomologicalNews27:152–154. 1994. Phylogenetic reconstruction of South American felids GOLDEN,R.2003.Leoparduscolocolo(on-line).AnimalDiversityWeb. defined by protein electrophoresis. Journal of Molecular Evolu- http://animaldiversity.ummz.umich.edu/site/accounts/information/ tion39:296–305. Leopardus_colocolo.html,accessed20April2010. PECON-SLATTERY, J., AND S. J. O’BRIEN. 1998. Patterns of Y and X GRAY, J. E. 1842. Descriptions of some new genera and fifty chromosomes DNA sequences divergence during the Felidae unrecorded species of Mammalia. Annals and Magazine of radiation.Genetics148:1245–1255. NaturalHistory,Series1,10:255–267. PECON-SLATTERY,J.,A.J.PEARKSWILKERSON,W.J.MURPHY,ANDS.J. GRAY,J.E.1867.Notesontheskullsofthecats(Felidae).Proceedings O’BRIEN. 2004. Phyolgenetic assessment of introns and SINEs of the Scientific Meetings of the Zoological Society of London withintheYchromosomeusingthecatfamilyFelidaeasaspecies 1867:258–277. tree.MolecularBiologyandEvolution21:2299–2309. HEMMER, H. 1978. The evolutionary systematics of living Felidae: PECON-SLATTERY,J.,L.SANNER-WACHTER,ANDS.JO’BRIEN.2000.Novel presentstatusandcurrentproblems.Carnivore1:71–79. gene conversion between X–Y homologues located in the non- HEMMER, H. 1979. Fossil history of the living Felidae. Carnivore 2: recombiningregionoftheY chromosomeinFelidae(Mammalia). 58–61. ProceedingsoftheNationalAcademyofSciences97:5307–5312. JARDINE,W.1834.Thenaturalist’slibrary.Vol.16.Mammalia.Part2. PEREIRA,J.,M.LUCHERINI,T.DEOLIVEIRA,E.EIZIRK,G.ACOSTA,AND Felinæ.W.H.Lazars,Edinburgh,UnitedKingdom. R.LEITE-PITTMAN.2008.Leoparduscolocolo.InternationalUnion fortheConservationofNatureandNaturalResourcesRedlistof JOHNSON, W. E., P. A. DRATCH, J. S. MARTENSON, AND J. S. O’BRIEN. threatened species. International Union for the Conservation of 1996. Resolution of recent radiations within three evolutionary NatureandNaturalResources,Gland,Switzerland.www.iucnredlist. lineages of Felidae using mitochondrial restriction fragment length org,accessed7September2011. polymorphismvariation.JournalofMammalianEvolution3:97–120. JOHNSON,W.E.,ANDS.JO’BRIEN.1997.Phylogeneticreconstructionof PERINI,F.A.,ETAL.2009.Carnivores(Mammalia,Carnivora)fromthe QuaternaryofSerradaBodoquena,MatoGrossodoSul,Brazil. the Felidae using 16S rRNA and NADH-5 mitochondrial genes. ArquivosdoMuseuNacional,RiodeJaneiro67:119–128. JournalofMolecularEvolution44,supplement:98–116. JOHNSON, W. E., ETAL. 1999. Disparate phylogeographic patterns of POCOCK,R.I. 1917.Theclassification ofexisting Felidae. Annalsand MagazineofNaturalHistory,Series8,20:329–350. moleculargeneticvariationinfourcloselyrelatedSouthAmerican smallcatspecies.MolecularEcology8,supplement: 79–94. POCOCK,R. I. 1941. The examples ofthe Colocolo and ofthe pampas cat in the British Museum. Annals and Magazine of Natural JOHNSON, W. E., ETAL. 2006. The late Miocene radiation of modern History,Series11,7:257–274. Felidae:ageneticassessment.Science311:73–77. JOHNSON, W. E., ETAL. 1999. Disparate phylogeographic patterns of PREVOFSeTlIi,daFe.)Jf.ro2m006s.oNutehwernmaSteoruiatlhoAf mPleeriisctoacewniethcactsom(Cmaernntivsoroan, moleculargeneticvariationinfourcloselyrelatedSouthAmerican biogeographyandthefossilrecord.Geobios39:679–694. smallcatspecies.MolecularEcology8,supplement: 79–94. KRETZOI, M., AND M. KRETZOI. 2000. Fossilium catalogus animalia. REDFtOhReDs,oKut.hHer.,nAcNoDneJ..FU.nEivISeErNsiBtyERoGf.C19h9ic2a.gMoaPmremssa,lCsohfictahgeoN,Ielolitnrooipsi.cs: Indexgenerumetsubgenerummammalium.BackhuysPublishers, Leiden,TheNetherlands. SALLES, L. O. 1992. Felid phylogenetics: extant taxa and skull morphology (Felidae, Aeluroidea). American Museum Novitates LABRUNA,M.B.,ETAL.2005.Ticks(Acari:Ixodida)onwildcarnivores 3047:2–64. inBrazil.ExperimentalandAppliedAcarology36:149–163. SA´NCHEZ-SOTO,S.2007.NuevoregistrodeOncifeliscolocolo(Felidae)para LINNAEUS,C. 1758. Systemanaturae per regnatria naturæ, secundum elPantanaldeBrasil.RevistaMexicanadeBiodiversidad78:211–212. classes, ordines, genera, species, cum characteribus, differentiis, SCHINZ,H.R.1821.DasThierreicheingetheiltnachdemBauderThiereals synonymis, locis. Tomus I. Editio decima, reformata. Impensis Grundlage ihrer Naturgeschichte und der vergleichenden Anatomie DirectLaurentiiSalvii,Stockholm,Sweden. vondemHermRittervonCuvier.EsterBand,Sa¨ugethiereundVo¨gel, LINNAEUS,C.1771. MantissaplantarumalteragenerumeditionisVIet Stuttgart,Germany. specierumII.ImpensisDirectLaurentiiSalvii,Stockholm,Sweden. SCHREBER,J.C.D.VON.1775.DieSa¨ugethiereinAbbildungennachder LUCHERINI,M.,L.SOLER,ANDE.L.VIDAL.2004.Apreliminaryrevision Natur, mit Beschreibungen. Stiegfried Leberecht Crusius, Leipzig, of knowledge status of felids in Argentina. Mastozoolog´ıa Germany. Neotropical11:7–17. SCHWANGART,F.1941.Su¨damerikanischeBusch-,Berg-undSteppenkat- MASUDA,R.,J.V.LOPEZ,J.P.SLATTERY,N.YUHKI,ANDS.J.O’BRIEN. zen. Bayerische Akademie der Wissenschaften, Abhandlungen der 1996. Molecular phylogeny of mitochondrial cytochrome b and Mathematisch-naturwissenschaftlichenKlasse,NeueFolge49:1–44. 12S rRNA sequences in the Felidae: ocelot and domestic cat SEIDENSTICKER,J.,ANDS.LUMPKIN.2004.Cats:theSmithsoniananswer lineages.MolecularPhylogeneticsandEvolution6:351–365. book.SmithsonianInstitutionPress,Washington,D.C. MATTERN, M. Y., AND D. A. MCLENNAN. 2000. Phylogeny and SEVERTZOV, M. N. 1858. Notice sur la classification multie´riale des speciationoffelids.Cladistics16:232–253. carnivores,spe´cialementdesfe´lide´de´s,etlesetudesdezoologiege´ne´rale MILLER, F. W. 1930. Notes on some mammals of southern Matto quis’yrattachent.RevueetMagazinedeZoologie9:358–393. Grosso,Brazil.JournalofMammalogy11:10–22. SILVA, J. C. R., ETAL. 2001. Seroprevalence of Toxoplasma gondii in MOLINA, G. I. 1782. Saggio sulla storia naturale de Chili. Nella captive Neotropical felids from Brazil. Veterinary Parasitology StamperiadiS.Tommasod’Aquino,Bologna,Italy. 102:217–224. NAPOLITANO,C.,ETAL.2008.Ecologicalandbiogeographicalinferences SILVEIRA,L.1995.Notesonthedistributionandnaturalhistoryofthe oftwosympatricandenigmaticAndeancatspeciesusinggenetic pampascat,Feliscolocolo,inBrazil.Mammalia59:284–288. identificationoffaecalsamples.MolecularEcology17:678–690. SILVEIRA, L. 2005. Carnivore population ecology in Cerrado environ- NASCIMENTO,F.O.DO.2010.Revisa˜otaxonoˆmicadogeˆneroLeopardus ment.JaguarConservationFund,EarthwatchInstitute,Maynard, Gray, 1842 (Carnivora, Felidae). Ph.D. dissertation, Instituto de Massachusetts. BiocieˆnciasdaUniversidadedeSa˜oPaulo,Sa˜oPaulo,Brasil. SOISALO,M.K.,ANDS.M.C.CAVALCANTI.2006.Estimatingthedensity NOWAK, R. M. 1991. Walker’s mammals of the world. 5th ed. Johns of a jaguar population in the Brazilian Pantanal using camera- HopkinsUniversityPress,Baltimore,Maryland. traps and capture–recapture sampling in combination with GPS NOWELL, K., AND P. JACKSON. 1996. Wild cats: status survey and radio-telemetry.BiologicalConservation129:478–496. conservationactionplan.InternationalUnionforConservationof SUNQUIST, M. E., AND F. C. SUNQUIST. 2002. Wild cats of the world. NatureandNaturalResources,Gland,Switzerland. UniversityofChicagoPress,Chicago,Illinois. O’BRIEN, S. J., AND W. E. JOHNSON. 2007. The evolution of cats. SUNQUIST, M. E., AND F. C. SUNQUIST. 2009. Family Felidae (cats). ScientificAmericanMagazineJuly:68–75. Pp. 54–169 in Handbook of the mammals of the world. Vol. 1. 44(891)—Leopardusbraccatus MAMMALIANSPECIES 25 Carnivores (D. E. Wilson and R. A. Mittermeier, eds.). Lynx WIED-NEUWIED, M. 1823. Abbildungen zur Naturgeschichte von Edicions,Barcelona,Spain. Brasilien. VerlagedesGrossherzoglichenSa¨chsLandes-Industrie- THOMAS,O.1903.NotesontheNeotropicalmammalsofthegeneraFelis, Comptoirs,Weimar,Germany. Hapale,Oryzomys,Akodon,andCtenomys,withdescriptionsofnew WOZENCRAFT,W. C.2005. Order Carnivora. Pp. 532–628in Mammal species.AnnalsandMagazineofNaturalHistory,Series7,12:234–243. speciesoftheworld:ataxonomicandgeographicreference(D.E. TRIGO, T. C., ET AL. 2008. Inter-species hybridization among WilsonandD.M.Reeder,eds.).3rded.JohnsHopkinsUniversity Neotropical cats of the genus Leopardus, and evidence for an Press,Baltimore,Maryland. introgressive hybrid zone between L. geoffroyi and L. tigrinus in XIMENEZ,A.1961.NewsubspeciesofpampascatfromUruguay,Felis southernBrazil.MolecularEcology17:4317–4333. colocolo mun˜oai. Communicaciones Zoologicas del Museo de TROLLE,M.2003.MammalsurveyinthesoutheasternPantanal,Brazil. HistoriaNaturaldeMontevideo88:1–8. BiodiversityandConservation12:823–836. ZUERCHER,G.L.,P.S.GIPSON,ANDK.HILL.2001.Apredator–habitat WAGNER,J.A.1841.DieSa¨ugethiereinAbbildungennachdernature assessment for felids in the inland Atlantic forest of eastern mit Beschreigungen. Supplementband 2. Bob’schen, Erlangen, Paraguay: a preliminary analysis. Endangered Species Update Germany. 18:115–119. WAYNE, R. K., R. E. BENVENISTE, D. N. JANCZEWSKI, AND S. J O’BRIEN. 1989. Molecular and biochemical evolution of the Carnivora. Pp. 465–494 in Carnivore behavior, ecology, and PAMELA OWEN reviewed the fossil account and SERGIO SOLARI and evolution (J. L. Gittleman, ed.). Cornell University Press, ALFRED GARDNER reviewed the synonymies. Associate editor and Ithaca, New York. EditorofthisaccountwasMEREDITHJ.HAMILTON.