ebook img

Immunological Survey of Planktonic Embryos and Larvae of the Starfish Asterina pectinifera, Obtained from the Sea, Using a Monoclonal Antibody Directed against Egg Polypeptides PDF

9 Pages·1991·3.5 MB·English
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Immunological Survey of Planktonic Embryos and Larvae of the Starfish Asterina pectinifera, Obtained from the Sea, Using a Monoclonal Antibody Directed against Egg Polypeptides

Reference: Biol. Bull 181: 95-103. (August, 1991) Immunological Survey of Planktonic Embryos and Obtained Larvae of the Starfish Asterina pectinifera, from the Sea, Using a Monoclonal Antibody Directed against Egg Polypeptides SUSUMU IKEGAMI, TOMOKO MITSUNO, MASANORI KATAOKA, SATOSHI YAJ1MA, AND MIEKO KOMATSU1 Faculty ofApplied Biological Sciences. Hiroshima University, Kagamiyama 1-Chome. Hiroshima 724, Japan; and 'Department ofBiology, Higashihiroshima-shi, Faculty ofScience. Toyama University. Toyama 930, Japan Abstract. A monoclonal antibody, Kl, specifically rec- Introduction ognizes polypeptides with apparent molecular masses of The development ofa number of starfish species has 56 and 58 kDa, in the egg ofthe starfish Asterinapectin- beendescribed (Oguroand Komatsu, 1988). Nevertheless, ifera. The Kl antibody reacted with extracts prepared the embryos and larvae obtained from the sea have hith- and from ovaries, oocytes, morulae, blastulae, gastrulae, ertobeenunidentifiable, becausetheentireprocessoftheir bipinnariae. Brachiolariae, testes, pyloricceca,bodywalls, development and metamorphosis is not sufficiently well and tubefeet did not contain Kl-reactive antigenic mol- known. Furthermore,theidentification ofindividualspe- ecules. Extracts ofeggs ofthe starfish Asterias amurensis cies by examination of external morphological features and several sea urchin species did not react with the Kl alone tends to be equivocal. Therefore, specific methods antibody. Amongthe members ofthegenusAsterina, ex- fordetectingchemical components presentexclusively in tracts of brachiolariae of .1. batheri and A. minor were embryos and larvae ofone species are needed. not reactive, whereas blastulae and brachiolariae of A. We report the discovery ofspecific antigenic polypep- pseudoexigua padfica did contain an antigenic compo- tides that are present in eggs, embryos, and larvae of,4s- nent. Unlike the antigenic peptides in A. pectinifera eggs, terina pectinifera. but not in those of other species be- the apparent molecular mass ofthe antigen molecule in longingto the same genus. A single embryo orlarva in a embryos and larvae ofA. pseudoexigua padfica was 41 complex plankton mixture can be detected by immuno- tkiDoan,owfhiancthigreenpremsoelnetcsulaesr.emUasriknagbltehephKyllogaennteitbiocdyv,ariwae- alosgsiacyal(EaLnaIlSyAs)isorwiitmhmuannoebnlzoytmep-rloicnekdeurde,imumsuinngosaomrobneont- havedeveloped anassaysystemthatdetectsembryosand clonal antibody that recognizes the unique antigen mol- larvae ofA. pectinifera in complex mixtures ofbiological ecules present in embryos and larvae. specimens obtained from the sea. Materials and Methods Received 10December 1990:accepted 1 April 1991. Animals CaAFbSbWre.vicaatlicoinusm:-fArSeWe,seaartwiaftiecira;lsDe-awMaEteMr,,BDSuAl,bebcocvoi'nsesmoedriufmicaaltbiuomnino;f Adults ofthe following starfish and sea urchin species Eaglemedium;EL1SA,enzyme-linkedimmunosorbentassay;PCS,fetal were collected, during their breeding seasons, along the calfserum;FITC, fluorescein isothiocyanate; HAT.hypoxanthine-ami- coastoftheJapan Islands.Thestarfishwerecollectedfrom nopterine-thymidine;IgG,immunoglobulinG;kDa,kilodaltons;NSW. the following areas: A. pectinifera off Asamushi in normalseawater,PBS,phosphatebufferedsalinewithoutdivalentcations; Aomori Prefecture, off Otsuchi in Iwate Prefecture, off TP-MSTFB.S,p0h.e5nyMlmNetahCyll,su1l0fomnAy/iTfnlsuo-rHidCel;(SpDHS,7.8s)odainudm0.d0o5d%ecTylweseunlfa2t0e.; Hashirimizu in Kanagawa Prefecture, off Sensui Island 95 96 S. IKEGAMI ET AL. in Hiroshima Prefecture, and offGogo Island in Ehime blotted onto nitrocellulose sheets(Bio-Rad), asdescribed Prefecture; Asterina pseudoexigua pacifica from the below. undersurface ofstonesatthe intertidal zone ofKushimoto inWakayama Prefecture;andAsterinaminorandAsterina batheri along the coast ofthe Noto Peninsula in Ishi- Preparation ofantigens kawa Prefecture. The sea urchins, Scaphechinus mirabilis, Mature eggs(3 ml packed volume) from A.pectinifera, Hemicentrotus pulcherrimus, and Pseitdocentrotus de- shed from the isolated ovaries ofadults by application of pressus, were collected off Sensui Island in Hiroshima 1-methyladenine at a final concentration of 150 ng/ml, PSruegfaescthuirmea, oIfsflaKnidwiandoMiien PYraemfeacgtuucreh,irePsrpeefcetcitvuerley,.and off wstearretedc.olTlheectyedwer1ehwaasfhteerd,thbey sheottrlminogn,eint5revaotlmeonftAhSaWd The plankton samples were collected by a diver and homogenized, in a Potter-Elvehjem glass homoge- equipped with SCUBA, who towed plankton nets (100 nizer, at 0C in 12 ml 20 mA/Tris-HCl (pH 7.5) buffer ^m-mmesh; open mouth, 40 cm in diameter) horizontally with 0.1 mA/phenylmethylsulfonyl fluoride (PMSF). The 50 at discrete depths off Sensui Island in Hiroshima subsequent procedures were carried out at 4C, unless Prefecture. otherwise stated. The homogenate was centrifuged at 18,000 X gfor 20 min. The pellet was resuspended in 15 Gametes, embryos, andlarvae ml 20 mA/Tris-HCl (pH 7.5)bufferwith 0.1 mAlPMSF, Fertilizable eggs were induced to spawn from isolated and the suspension was centrifuged again. The superna- ovaries offemale A. pectinifera and A. amurensis by ap- tants were combined, and solid ammonium sulfate was plication of 1-methyladenine at a final concentration of added toa final ammonium sulfateconcentration of20% 150 ng/ml (Kanatani, 1973). SpawnedA. pectiniferaeggs (w/v). The mixture was stirred for 1 h, then centrifuged werewashed several timeswith artificial seawater ASW), at 18,000 X gfor 20 min. The supernatant was removed, Jamarin U (Jamarin Laboratory, Osaka),and insem(inated theammonium sulfateconcentration wasadjusted to 80% at40-60 min afterthe startof 1-methyladenine treatment. (w/v) by adding solid ammonium sulfate, and 1 h later, Formed embryos were cultured in ASW at 23 2C, the mixture was centrifuged as before. The precipitate and theearlybrachiolariaewere reared in natural seawater wasremovedanddissolved in 21loadingbuffer,composed (NSW), which waskept in thesun and changedeverytwo of50 mAl Tris-HCl (pH 7.4) with 0.1 mA/ PMSF. The or three days. Embryos ofA. hathen were obtained sim- solution was then loaded onto a Whatman DE-52 ion- ilarly. Embryos and larvae of hermaphroditic A. minor exchange resin column (2.5 X 3.3 cm), which had been were obtained from acontainerofadult coloniescollected equilibrated with loading buffer. Step-wise elution was duringthe breedingseason, duringJuneatthe Noto Pen- performed with solutions ofNaCl in loading buffer using insula in Ishikawa Prefecture. Embryos and larvae ofA. 50 ml each of20, 150, 200, and 500 mAlconcentrations. pseudoexiguapacificawerecollected from thebody cavity The fractions eluted with 150 and 200 mA/ NaCl were of the adult during the breeding season, in July at Ku- pooled and dialyzed against phosphate-buffered saline shimoto in Wakayama Prefecture. Eggs of sea urchins without divalent cations (PBS). The non-dialyzable frac- were obtained by introducing 0.5 M KC1 into the body tion was frozen at -80C for future use. cavity. Eggs, embryos, and larvae were washed several times ASW NSW ~80C Preparation oj nuclei with or before being stored at until required. Two thousand, five hundred (2500) A. pectinifera em- bryos were washed twice with calcium-free seawater Protein detenuinution (CaFSW, Jamarin Laboratory, Osaka; 4C)and oncewith Protein wasdetermined by the protein-dye binding as- buffer A (4C), which consisted of 250 mA/ sucrose, 5 mA/ MgCl 40 mA/ NaCl, and 50 mA/ Tris-HCl (pH say, with bovine serum albumin (BSA) as the standard :, (Bradford, 1976). a7t.5)4.CTheinyw5emrlehboumffoegrenAizceodntwaiitnhinagDo1u%n(cwe/vh)omTorgietnonizXe-r 100. The homogenate was passed through a40-/um stain- Sodium dodecyl sulfate-polyacrylamidegel less steel filter by gravity. The filtrate was centrifuged at electrophoresis 1000 X gat 4C for 5 min. The nuclear pellet was resus- Discontinuous sodium dodecyl sulfate (SDS)-poly- pended in 2.5 ml buffer A, followed by centrifugation at acrylamide gel electrophoresis was performed with 5% 1000 X gfor 5 min. This processwas repeated once. The stacking gel, as described by Laemmli (1970). The gels washed nuclear preparations were frozen at -80C for were then stained with Coomassie brilliant blue R-250 or future use. IMMUNODETECTION OF STARFISH LARVAE 97 Monoclonal antibodyproduction Rad) were incubated with undiluted culture supernatant A 7-week-old BALB/c female mouse was injected in- awtit3h7diCstiflolred2wahtewri,ththgeeyntwleersetitrhrienng.waAsftheerd,afborrie1f0wmaisnh traperitoneally with 100 jxgprotein in complete Freund's each, in two changesofexcess 10 mA/Tris-HCl (pH 7.4), taidojnusvaonft.50FMogurpraontedinthweenrefiavdemwineiesktserleadte.r,Abnodosttherreeindjaeycs- a0t.537A/CNawiCtlhahnodrs0er.a0d5i%shTpweereoxnid2a0,sea-ncodnjiungcautbeadtegdoaftoran2tih- after the second booster, the mouse was sacrificed, its mouse IgG (Bio-Rad) diluted 1:3000 in the same buffer mo(sXupiDltn1-e,0Mei7nnEwsiMwp1t)lahe,smelmnrwyiecDetmeulholloovlbuemsetd/ca,mcsyoceaee'rlnlsluodsmmm,(otaShdbPceieu-flt2clie)sclc)al.o(stanTittahoalaneilnrofoaiwuftnesigdiEooa5tnogo0flwe%fa1ussmpXeoec,lady1rfie0rotiru8h/em1-8d twushstaaiostnphgpiwenaHdgs2baOygua2srieinadn,nsdisttnorg4i-pwbcsilhtowlhceokrrwoea-ttahlees-rsnaaanpyinhetdtrdohscfoteolrrli.lppusTelwrohesoeerxierdsedtaarrsicieptesid.aocnitAnifvwatiiaetrsry. ylene glycol-6,000. To stop the fusion, 20 ml D-MEM obtParionteedinbbyloetlsecotfrooopchyotreest,icegtgrsa,nsefmebrryforso,maSnDSd-lpaorlvyaaecwreyrle- wceanstraidfduegdatdiroonpa-twi2s5e0, aXngdfcoelrl5pemlilnet.sTwhereeceplrlecpieplilettastewderbey amide gel to nitrocellulose sheets and then treated as resuspended in 5 ml D-MEM containing 5% fetal calf specified above, except that the IgG solutions, diluted 1: serum (FCS, Microbiological Associates), incubated for 100to 1:1000 in PBS, wereused forantibodyincubations instead ofhybridoma culture supernatant. 12-18 h. then plated in 98-well microtiter dishes at 200 l/l/well in HAT medium (complete D-MEM containing 1 X 10~4A/hypoxanthine, 4 X 10~7A/aminopterin, 1.6 Immunofluorescence microscopy X 10~5A/thymidine, and 10% FCS). Halfofthe medium EmbryoswerewashedtwicewithASW, fixedwith 100% wasremoved from eachwell and replaced with fresh HAT methanol for 10 min, immersed in 100% ethanol for 10 medium after2,4, 7, and 10days. The supernatantswere min andthenembedded in polyesterwax(BDH). Sections harvested when theclonesbegan to exhaust their medium 7 jim thick were placed onto 0.1% (w/v) amylopectin- and were screened byprotein blotting, asdescribed below. coatedcoverslipsand incubatedwith IgGsolutiondiluted Hybridomas that showed reactivity were expanded and 1:100 in PBS for 1 h, at room temperature, after which subcloned by limited dilution. they were washed in PBS for 30 min. Fluorescein iso- Hybridomas (1 X 107 cells) were injected intraperito- thiocyanate (FITC)-conjugated goat anti-mouse IgG neally intoa BALB/c mousewhich, 1-2 weeks previously, (Tago),diluted 1:200inPBScontaining2% BSAwasthen at 8 weeks old, had received an injection of 0.5 ml added and the sections were incubated, in the dark, at 2,6,10,14-tetramethylpentadecane. Onetotwoweeksafter room temperature, for 1 h, afterwhich they were washed the injection of hybridomas, the ascites were collected with PBS for 30 min. Coverslips were mounted in a so- and centrifuged at 1500 X gfor 30 min. The supernatant lution of20% glycerol in PBS, sealed, and viewed under ( 1 ml)wasdialyzed, at 4C, against 50 mA/Tris-HCl (pH a Nikon TMD-EP2 photomicroscope. Photographs were 8.6) with 0.15 A/ NaCl. The non-dialyzable fraction was then taken using Kodak Tri-X pan ASA 400 film. loaded onto a column (0.6 X 10 cm) ofProtein-A cellu- lofine (Seikagaku Kogyo, Tokyo), which had been equil- ELISA assay 0Ai.fbr1ta5etreAwd/awNsiahtCihln,5g0wtmihetAh/iTM3mr0miumsnl-oHg5Cl0lomb(Aup/lHTirn8.iG6s)-w(HiICtglhG)0(.pf1rH5ac8At./i6o)NnawwCialt.sh b6o2i.Fl5ievdmeAf/tohTror2uissma-inHndCli(n5(01p00Hm)l6o.8oS)cD,ySt2e%ss,aSmeDpgglSse,abnourdffe5emr%bcr2oy-nomtseariwcneairpne-g eluted out by 0.05 sodium acetate (pH 4.0) and 0.15 toethanol (Laemmli. 1970). One hundred microliters of A/NaCl. The pH ofthe IgG solution was adjusted to 7.2 each ofthe extracts, at a dilution of 1:2000 in PBS, were by adding 1 A/ Tris-HCl (pH 9.0). The protein concen- addedtoawellofa microtiterplateforELISAassay(Pro- tration was adjusted to 500 Mg/ml, and then the IgG so- lution was frozen at -80C for future use. bind, Falcon), the content of the lysate in a well being equivalentto0.25 oocytes,eggs, orembryos, andabsorbed for2 h at 37C. The solution wasremoved, and the wells Immunoblotting were treated at room temperature with 200 n\ PBS with For screening hybridomas, nitrocellulose blots were 1% BSA for30 min. The IgG solution wasdiluted 1:1000 prepared by electrophoretic transfer from preparative in PBS, a 100-^1 aliquot was added to each well and in- SDS-polyacrylamide gels ofthe 150 and 200 mA/ NaCl cubated for 2 h at 37C. The wells were washed twice fractions obtained by Whatman DE-52 ion-exchange with T-TBS buffer, composed of0.5 A/ NaCl, 10 mA/ chromatography, performedasdescribed above, followed Tris-HCl (pH 7.4), and 0.05% (v/v) Tween 20, and then by blocking in a solution of 10 mA/Tris-HCl (pH 7.4), three times with distilled water. One hundred microliters 0.5 A/ NaCl and 3% gelatin. Nitrocellulose strips (Bio- ofa solution ofhorseradish peroxidase linkedtogoat anti- 98 S. IKEGAMI ET AL against A. pectinifera egg components with molecular abcdef abcdef masses of 188 or 133 kDa. All ofthese antibodies were (kDa) found to bind to some components ofA. amurensiseggs. One clone produced an antibody that recognized com- ponentsof.-1. pectiniferaeggs,butnotthoseofA. anniren- sis eggs, in an ELISA assay. This specific antibody, Kl, bound to A. pectinifera egg components with molecular masses of58 and 56 kDa in an immunoblot assay (Fig. 1 ). The immunoreactive components were also present in extracts ofA. pectinifera oocytes and embryos at the 32-cell morula, the 256-cell early blastula, mid-blastula 30- (10 h after fertilization), and early gastrula (24 h after A fertilization) stages. Protein binding experiments in- dicated that the Kl antibody was ofthe IgG class. The minimum number of eggs detectable by immu- noblot analysis was then determined as follows. Graded amounts ofegg lysate were loaded into slots ofan SDS- polyacrylamide gel. After electrophoresis, the gel was (5FMiggpurroete1i.neIamcmh)unwoebrleoetlsecotfr.olphMocrnemsiedpeocntinSiDfSe-ra12ex.t5r%actpso.lTyahceryexltarmaicdtes wbliotthtetdheonKtloaantniibtordoyc.elTluhleosleysfailtteerobtthaatinweadsftrhoemnopnreobsiexd- gels.GelswereeitherstainedwithCoomassiebrilliantblue(A),ortrans- teenth ofan egg and loaded into a slot gave two bands at blottedontoanitrocellulosefilter,whichwasprobedwithculturemedium molecular masses of58 and 56 kDa. The intensity ofthe conditionedbyaKl antibody-producinghybndomacellline(B). Lanes bandswasclosetothelimitofdetection (data notshown). a,b,c.d,e.andfcorrespondtotheextractofoocyles,eggs, 32-cell-stage To determine whether the antigenic molecules were morulae, 256-cell-stageblastulae. mid-blastulae(10hafterfertilization) andearlygastrulae(24 h after fertilization), respectively. polypeptides, we incubated 5 ^g egg extract protein with 0.001 to 0.01 units of papain at 37C for 30 min and subjected the reaction mixture to SDS-polyacrylamide gel mouse IgG, diluted 1:3000 in PBS with 0.05% Tween 20 electrophoresis. The gel was blotted onto a nitrocellulose and 1%gelatin, wasaddedthen incubated for2 hat37C. filter, which was probed with the Kl antibody. The 58- The wells then were washed twice with T TBS followed by three times with distilled water. Two hundred microliters of substrate solutions con- abode abcde taining H:O: and o-phenylenediamine were added, left (kDa) for 10-30 min, and then the reaction was stopped by the addition of 100 ^1 4 N H:SO4. The absorbance at 492 nm was measured within 30 min ofthe sulfuric acid ad- dition. When the primary antibody was replaced with preim- mune serum, orwasomitted, the result wasa completely negative one. Results Mice were immunized with the pooled 150 and 200 mAl NaCl eluates obtained by Whatman DE-52 ion-ex- changeresinchromatography toproduce monoclonalan- tibodies that would react with components present in A. pectinifera eggs, but not with any components of A. amitrensis eggs. The spleen was dissociated from the im- munized mice. The cells were fused to myeloma cells Figure 2. ImmunoblotsoftissuesofadultAslerinapectinijera. The platedataclonaldilution. From thisfusion, 30hybndoma extracts(5^gproteinseach)wereelectrophoresedonSDS-10%acrylamide clonesgrew. Hybndoma cloneswere selected byscreening ogenlts.oGneiltsrowceerlelueliotsheeransdtaipnreodbweidthwiCtohomthaessKilebarnitlliibaondtybl(uBe),(Aa)sodresbclroitbteedd antibodies secreted in the media with the ELISA and im- in Materialsand Methods. Lanesa,b,c,d,andecorrespondtoextracts munoblot assays. Thirteen clones produced antibodies ofovary, pyloriccecum, testis, body-wall and tube-foot, respectively. IMMUNODETECTION OF STARFISH LARVAE 99 Aabcde Babcde analysisofthesefractionsshowedthatp58/56werepresent in the cytoplasmic, but not in the nuclear fraction, as (kDa) shown in Figure 4. Embryoswerefixedwith methanol, embedded inpoly- ester wax, sectioned, and the sections subjected to im- munofluorescence staining. The Kl antibody stained the 94- cytoplasm, but not the nucleus ofan 8-cell-stage embryo 67- (Fig. 5a). Figure 5bshowsasection ofabipinnaria(4days after fertilization) that was stained with the Kl antibody. Almostall oftheembryoniccellscontainedsomeantigen 43- molecules. Occurrence ofantigen molecules in other 30- Asterina species We attempted to survey the distribution ofantigens in the eggs and embryos of some sea urchin and starfish Figure 3. ImmunoblotsofextractsofAsterinapectiniferaeggsand species. Lysates were prepared from eggs of5". mirabilis, embryos-Theextracts(5jigproteineach)wereelectrophoresedonSDS- P. depressus. H. pulcherrimus, andA. amurensisandwere b1l0u%ep(oAl)yoarcrbylloatmteiddeongetlos.nGietlrsocweelrlueleoistehearnsdtapirnoebdewditwhitChootmheasKslieanbrtiilblioadnyt subjected to immunoblot analysis; 10 ng of lysate were (B)asdescribed in Materialsand Methods. Lanesa. b, c. d. and ecor- loaded into each slot. The analysis showed that no mol- respondtotheextractofeggs, 1-day-oldearlygastrulae, 2-day-oId mid- eculesreactivewiththe K1 antibodywerepresentinthese gastrulae. 3-day-old late gastrulae and 4-day-old early bipinnariae, re- sea urchin and starfish eggs (Fig. 6). spectively. Next,weexaminedembryosofspeciesbelongingtothe genus Asterina: A. minor, A. pseudoexigua pacifica, and and 56-kDa forms were no longer detectable on the im- A. batheri. Development ofthese species is direct, with munoblot, and prominent degradation products with molecularmassesof49, 46, 43,and40 kDawereobserved (data not shown). Treatment ofan identical amount of Whole embryo Nucleus extractwithahigheramount (0.1 unit)ofpapain resulted abcdef bcde in total loss ofimmunoreactivity. These results demon- (kDa) strate that the components recognized by the antibody were proteinaceous. The immunoreactive 58- and 56-kDa proteins were designated p58/56. Distribution ofthe antigens in tissues, oocytes and 58-L embryos ofA. pectinifera 56-T Several tissues were excised from adult A. pectinifera, and their extracts were examined, by immunoblot anal- ysis, to determine whether Kl-reactive antigens were present. Antigenic p58/56 were found to be present in ovarian extracts ofovaries, whereas testes, pyloric ceca, and tube-feet contained no antigenic components (Fig. 2). Next, we surveyed extracts of hatched embryos and larvae by immunoblot analysis and found that p58/56 were present in all the samples examined; the amount of p58/56, on a protein weight basis, was almost constant throughout early embryonicdevelopment upto theearly Figure 4. Immunoblots ofwhole and nuclear extracts ofAsterina bipinnaria stage (Fig. 3). pectiniferaembryos. Theextracts(5 ngproteinseach)wereelectropho- resed on an SDS-12.5% polyacrylamide gel. The gel was blotted onto Subcellular localization oftheantigens in A. pectinifera nitrocelluloseandprobedwiththeK.1 antibody,asdescribedinMaterials eggs and embryos and Methods. Lanesa, b,c,d,e. andfcorrespondtotheextractsatthe 32-cell morulae, 256-cell earlyblastulae, 512-cell early blastulae, 1024- Embryonic extracts were separated, by centrifugation, cellearlyblastulae, mid-blastulae(10hafterfertilization)andearlygas- into nuclear and cytoplasmic fractions. Immunoblot trulae(24 hafterfertilization), respectively. 100 S. IKEGAMI ET AL Detection ofA. pectinifera embryos in the ocean As A. pseudoexigna pacifica never swims or drifts at any stage ofits life cycle (Komatsu el ai, 1990), its em- bryos and larvae should not be present in specimens col- lected from the sea with a plankton net. A. pectinifera, however, startsitsplanktonic life atthe late blastula stage and then sinkstothebottomatthelatebrachiolariastage. Therefore, we would expect that an ELISA system, with the Kl monoclonal antibody as the detecting antibody, could be used to quantify embryos and larvae ofA. pec- tinifera in a complex planktonic sample. We assessed the sensitivity ofthe assay system forem- bryosofA. pectiniferaby testinggraded quantities ofem- bryos. Five thousand (5000) embryos, at each develop- mental stage, were boiled in 1 ml SDS sample buffer, the lysateswerediluted 1:5000to 1:40,000in PBS,anda 100- jul aliquot was added to a well of a microtiter plate for ELISA. The absorbance decreased as development pro- gressed, although on a per protein weight basis, the ab- sorbancewasnearlythesameforall stagesoftheembryos examined. The protein content ofa single oocyte, egg, or embryo at the mid-blastula stage (9 h after fertilization) was 0.30 /*g; that ofa single embryo at the mid-gastrula stage (24 h after fertilization) was0.21 ^g; and that ofan earlybipinnaria(72 hafterfertilization) or mid-bipinnaria (96 h after fertilization) was0.10^g- The absorbance val- ueschanged linearlywithconcentration overthe following Figure 5. Immunotluorescence microscopy ofsections ofAstcrina pectiniferaembryosusingtheK1 antibody. AandBcorrespondtoa32- cell morulaandanearly bipmnana. respectively. Barindicates 100/jm. A bed B abed ThemagnificationofB isthesameasthatofA. (kDa) a nobipinnariastage, unlikethatofA. pectinifera. A. minor is hermaphroditic (Komatsu, 1976), and when spawning occurs, theanimalsclingtooneanotheralongthemargins 94- oftheir bodies, or they are imbricated with others (Ko- 67- matsu elai, 1979). Eggsthatwerespawnedspontaneously andfertilizedwerecultured in the laboratoryand allowed to develop into brachiolariae, which were then used for 43- immunoblot analysis. A. pseudoexignapacifica is ovovi- viparous(Komatsu el al.. 1990), and we were ableto col- lect early blastulae, wrinkled blastulae, and brachiolariae . from the adult ovary. Brachiolariae ofA. batheri (Kano 30- and Komatsu, 1978) were obtained by rearingartificially inseminated, spontaneously spawnedeggs. Theseembryos were boiled in SDS sample buffer and loaded onto a gel, which was electrophoresed and immunoblotted as de- Figure6. ImmunoblotsofeggsofScaphechinusmirahilix(a), Pseu- scribedabove. Noneofthepeptidesfrom thebrachiolariae (liiccnlroti/s ilcprcxsus (b), Hemicentrotus pulclicrimits (c), Asterias ofA. minor or A. batheri reacted with the Kl antibody amurensis(d),andAstcrinapectinifera(e).EggsweresolubilizedinSDS t(Fuilga.e,7)o.rBubrtawchhieonlalryisaaeteosfoAf.eaprsleyubdlaosetxuilgaen,awpraicnikfliceadwblearse- /esulagemcpptrlroeotpebhiuonfrfewesrae,sd,alnoadanddaendthoaelnnitqoeuioettahceorhfsltthaaenienseoadfmpwSliDteSh-sCo1lo0uo%tmiaopsnosleiyqeaucibrvryailllaleimnaitndtetobgleu1le0, separated on a gel, a band at 41 kDa was detected on the (A)orblotted ontonitrocelluloseand probedwiththe K.1 antibody(B). blot (Fig. 8). asdescribed in Materialsand Methods. IMMUNODETECTION OF STARFISH LARVAE 101 A B embryos or larvae present in a sample. We collected planktonic samples from 6 tons ofwater from the sublit- (kDa) a b c a b c toral zone ofHikonoura (1 or 3.5 m above thebottom of m thesea, ca. 100 offSensui Island, ca. 3423TV, 133 24T) at high tide on November 22, 1987. The samples were spun down at 1000 X g for 10 min, and the precipitate was lysed in SDS sample buffer. Aliquots ofthe lysates werediluted 1:1000 in PBS, addedtowellsofamicrotiter 94- plate, and assayed by the ELISA system. The observed valueswerecorrectedwith referencetoapreparationcon- taininga known numberofA. pectinifera embryosat the 67- mid-gastrula stage mixed with a standard amount of plankton lysate. The estimated numbers ofA. pectinifera embryosorlarvaeinthethreeplankton samplescollected separately from 6 tons each ofwater were 30, 130, and 43- 130, assumingthat the planktonic embryoswereall mid- gastrulae. As described above, these figures are the min- imum numbers of embryos and larvae present in the specimens, since the response oflysed larvae at later de- velopmental stages was low compared with that of the mid-gastrulae, as shown in Figure 9. 30- Discussion Figure7. ImmunoblotsofAstcriiitibatherihrachiolariae(a),Asterina Mochizuki and Hori (1980) examined the phylogenetic minorbrachiolariae (b), and Asterinapectinifera oocytes (c). Embryos relationship between fiveAsterina species by the enzyme andoocytesweresolubilizedinSDSsamplebufferandanaliquotofthe samplesolution, equivalent to 5 ng protein, wasloaded ontoeach lane ofSDS-10% polyacrylamidegel,electrophoresed,andthenstainedwith A B Coomassie brilliant blue (A) or blotted onto a nitrocellulose sheet (B). The sheet was probed with the K.1 antibody, asdescribed in Materials (kDa) a and Methods. ranges: 0.0125 to 0.05 individuals per well for oocytes, eggs, and mid-gastrulae(24 hafterfertilization);and0.025 94- to0.1 individualsperwell forearlybipinnariae(72 hafter fertilization) and mid-bipinnariae (92 h afterfertilization). 67- Itisnot known atwhich stage ofdevelopmenttheamount ofthe antigenic p58/56 in an embryo or larva becomes 43- lower than the detection limit ofthe ELISA system with the Kl antibody. However, we succeeded in rearing five early brachiolaria ofA. pectinifera (12 daysafterfertiliza- tion) by feeding bipinnariae in the laboratory. They were 30- all loaded intoaslotofan SDS-polyacrylamidegel, which wassubjected, afterelectrophoresis, toimmunoblot anal- ysis. The sensitivity of the immunoblot analysis is ap- proximately five times lower than that ofthe ELISA sys- tem used in this study. There were no immunoreactive abamnodusntonoftph5e8/sl5o6t p(rdeasteantnoitn ashloawrvna),atstuhgegemsitdi-nbgiptihnantartihae terFiingauprsee8u.doeIxmimguuanopbalcioftiscaofeaArsltyebrliansatupleaceti(nbi)f,erwarionokclyetdesbl(aa)s,tualnadeA(cs)-. stage decreased to less than 10% as development pro- and brachiolariae (d). Embryos and oocytes were solubilized in SDS gressed to the early brachiolaria stage. sample buffer,andan aliquotofthesamplesolution, equivalent tofive Although neitherembryos nor larvae at various devel- oocytesorembryos, wasloaded ontoeach laneofSDS-10% polyacryl- opmental stagescould bequantified bythe ELISA system, ablmuiede(A)gelo,reblleocttterdopohnotreosaedn,itarnocdeltlhuelnosestsahieneetd(wB)i.thThCeoosmheaestsiweasbrpirlolbiaendt it could be used to estimate the minimum number of with the Kl antibody, asdescribed in Materialsand Methods. 102 S. IKEGAMI ET AL. 25 time as members of the plankton community before moving into the benthic environment and undergoing 20 metamorphosis. Therefore, the Kl antibody-reactive componentsdetected bythe ELISAassay in theplankton specimen were very unlikely to have been derived from embryos or larvae ofA. pseudoexiguapacifica. Although we did not analyze the plankton specimens collected in c nnj 10 the field by immunoblot assay, thisassay can discriminate between embryos ofA. pseudoexigua pacifica and those 05 of A. pectinifera. according to the differences between molecular masses of the immunoreactive components. This enables A. pectinifera embryos and larvae in the mixed planktonic specimens to be identified unambigu- 0013 0025 0050 0100 ously. Number of individuals per well A. pectinifera differs from the otherAsterina species in that the size and yolk content ofits eggs are small, and Figure 9. Measurement ofantigen content in extracts ofAsterma that larval development, at both bipinnaria and brachio- pleatcelignaisfterrualoaoec(yAt)e,sa(nO)d,4e-gdgasy(-o)l,d1e-adralyy-ohlidpienanralryigaaest(rDu)lauesi(An)g,a3n-dEaLy-IoSlAd laria stages, is indirect (Oguro and Komatsu, 1988). system with the Kl antibody. The method ofmeasurement ofantigen Therefore, this speciescan usually be identified accurately contentisdescribed in Materialsand Methods. by microscopic examination ofa larval specimen. How- ever, there are huge numbers of diatoms in planktonic samplescollected from wateralongtheJapan Islands, and inhibition test, usingrabbitanti-.-l.pectinij'erahexokinase these makethedetection ofsmall numbersofstarfishem- antisera. The antisera inhibited the activity from hexo- bryos and larvae almost impossible. Therefore, an im- kinase ofA. bat/ieri, Asterina coronatajaponica, and A. munological search for embryos and larvae in a complex pseudoexigua pacifica by 50-54% and that ofA. minor plankton sample is particularly useful when their popu- by 30%. In light of these results, Mochizuki and Hori lation is thin. suggested that A. pectinij'era and A. minor, but not the Thisstudywasaimedatdeterminingthespawningsea- otherAstrinaspecies, belongtoconvergent lineages. Mat- son ofA. pectinifera at specified regions along the coast suoka(1981)arrived at a similarconclusion asa result of ofthe Japan Islands. Ten percent ofthe total number of electrophoretic analysis of hexokinase and six other en- adult A. pectinifera caught on 29 October 1987, at Hi- zymes from five Asterina species. In our study, a peptide konoura off Sensui Island, contained ripe ovaries with capable of recognizing the Kl monoclonal antibody, full-grown oocytes. This fell to 3% on 15 November and which isreactivetoA. pectiniferap58/56, wasfound only to 1.7% on 19 December. These observations suggest that, inembryosand larvaeofA. pseudoexiguapacificaamong at this sampling site, many adult A. pectinifera spawned theAsterina species examined. Since little information is at the beginning ofNovember. Forthree years, spawning available regardingthe function and structure ofthe pep- at this location has been observed to occurin November. tides containing the K1 epitope, the reason for the phy- Our results, obtained by immunological detection using logenetic variation of the peptides in these two species an ELISA system, forA. pectinifera embryos or larvae in remains unclear. plankton samplescollectedatthislocationon22 Novem- So far, A. pseudoexigua pacifica has been found only ber 1987, agree well with these observations. However, in Sabiura, ofFKushimoto in Wakayama Prefecture (Ko- inspection of the ovaries ofadults collected from other mm matsu el a!., 1990). It istiny (its body is only 5 long) areas along the coast of the Japan Islands revealed that and ovoviviparous. Development of this species, from the breeding season of this species is quite diverse, oc- fertilization to the completion ofmetamorphosis, occurs curring in May in Tokyo Bay in Kanagawa Prefecture, withinthegonad. Thejuveniles, measuringapproximately June in Ago Bay in Mie Prefecture, July and August in 0.5 mm in total length, crawl out ofthe gonad and pass thesouth-western partoftheInlandSeaofJapan in Ehime through the gonoduct. According to the observation of Prefecture. September in Mutsu Bay in Aomori Prefec- Komatsu and Kano, made in July and August of 1972, ture, and November in the Sea ofYatsushiro in Kuma- the maximum numberofjuvenilesreleased from asingle moto Prefecture. Thespawningseason in most otherparts adult was 1288 (Komatsu elal, 1990). On the otherhand, ofJapan is, as yet, unknown. The spawning season in a A. pectinifera is extremely abundant along the Japan Is- specified region oftheseacould bepredicted byanalyzing lands; an individual spawns more than 100,000 eggs, and plankton specimens, sampled periodically, with the im- it has embryonic and larval forms that live for a short munological assay method as described in this paper. IMMUNODETECTION OF STARFISH LARVAE 103 In summary, we have developed an assay system that Kanatani, H. 1973. Maturation-inducing substance in starfishes. Int. detects embryos and larvae ofA. pectinifera in complex Rev Cytol. 35: 253-298. biological specimens. The resultsofthe this investigation Kanok,rnYi.aTh.,alahnedriMG.olkoo.maDtt-sv,u.Gr1o97w8t.hDiDffeevre.l2o0p:me1n07t-o1f1t4.hesea-star,As- suggest that immunological techniques are useful tools komatsu, M. 1976. Wrinkled blastulaofthesea-star.Asterinaminor for taxonomic identification ofeggs, embryos, or larvae Hayashi. Dev. Growth Differ. 18:435-438. in plankton populations. komatsu, M.,Y.T.kano,andC.Oguro. 1990. Developmentofatrue ovoviviparousseastar,Asterinapseudoexiguapacifica Hayashi. Biol. Acknowledgments Bull 179: 254-263. komatsu. M., Y'. T. kano, H. Yoshizawa, S. Akabane, and C. Oguro. Thiswork was supported in part by aGrant-in-Aid for 1979. Reproduction and development ofthe hermaphroditic sea- Cancer Research from the Japanese Ministry of Educa- star,AsterinaminorHayashi. Biol Bull. 157: 258-274. tion, Science and Culture, and by grants from the Nissan Laemmli, II. k. 1970. Cleavage ofstructural proteins during the as- Science Foundation and from the Japanese Fisheries sembly ofthe headofbacteriophageT4. Nature221: 680-685. Agency to S.I. We thank Professor C. Oguro, Toyama Matsuoka, N. 1981. Phylogenetic relationshipsamong five speciesof University, for his valuable suggestions and encourage- sBtiaorcfihsehm.ofPhtyhseio/g.en7u0s.B:A7s3te9r-i7n4a3:.an electrophoretic study. Comp. ment. Mochizuki, Y., and S. Hori. 1980. Immunological relationships of starfish hexokinases: phylogenetic implication. Comp. Biochem. Literature Cited f'ln-Mol 65B: 119-125. Bradford, M. M. 1976. A rapidand sensitive method forthequanti- Oguro,C.,and M. komatsu. 1988. Asteroidea. Pp. 339-356inDevel- fication ofmicrogram quantities ofprotein using the principle of opment of Invertebrates, K. Dan, K. Sekiguchi, H. Ando and H. protein-dyebinding. Anal. Biochcm. 72: 248-254. Watanabe, eds. Baifukan, Tokyo, (in Japanese)

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.