ebook img

Human Reproduction and Male Infertility Center for Reproductive Medicine PDF

23 Pages·2015·11.72 MB·English
by  
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Human Reproduction and Male Infertility Center for Reproductive Medicine

Center for Reproductive Medicine Research Fellowship in Human Reproduction and Male Infertility Scientific Presentation Day, Summer Internship 2014, Lerner Research Institute Table of Contents For more information, please contact: Our Mission 2 Our Research Fellowship and training opportunities Center for Reproductive Medicine and the Andrology Center Testimonials 2-3 represent one of the most active, state-of-the-art Application 3 Cleveland Clinic, X-11 and comprehensive programs in human reproduction Who We Are 4 10681 Carnegie Avenue Books Published 4 and infertility in the United States. Cleveland OH 44195, United States Research Collaborators 5, 8, 9 Research Overview 6 – 14 Our Fellows gain priceless research experience under Tel: +1.216.444.9485 Publications 8 – 14 the strong mentorship of world-renowned experts in Toll-Free: 1.800.CCF.CARE (ext. 4-9485) Recent Research Alumni 15 – 16 reproductive medicine and biology at our Center in Fax: +1.216.445.6049 Fulbright Research Scholars 17 About Our Center 18 – 19 the Cleveland Clinic. Email: [email protected] Reproductive Research Alumni 20 – 22 http://www.ClevelandClinic.org/ReproductiveResearchCenter About Cleveland 23 Testimonials from Research Alumni: “The training that I received at your Program has made a profound impact on my professional career. My achievements in the field of male infertility and andrology have to be credited to the opportunity of being a Fellow at CRM. I truly believe that this is the best research fellowship program in reproductive medicine currently available both in the United States and abroad. The program not only met but exceeded its goals in every single aspect. It was a wonderful professional and personal experience for life.” Sandro Esteves, MD, PhD | 1995 – 96 “My memories of the Cleveland Clinic are of being pushed to work harder and to never accept mediocre quality of work. This program Our Mission teaches one to set high goals, and to become better at everything one does.” Our unique and methodical mentorship Fabio Pasqualotto, MD, PhD | 1998 – 99 approach develops our researchers into “I was extremely fortunate to work with renowned experts in the field of Reproductive Medicine from the United States, independent and dynamic scientists of Germany, and the U.K. as a part of their collaboration with the Center for Reproductive Medicine. The innovative the highest caliber. research that we produced remains a cornerstone in the areas of sperm sorting and sperm genomic integrity. I was able to publish over 30 articles in high-impact Reproductive Medicine Journals as well as book chapters. In addition, I was provided with the opportunity to Our Research Fellows will attend several international conferences during which I presented over 60 oral and poster presentations.” • Receive personalized mentoring by well-known experts in Reproductive Research Tamer Said, MD, PhD | 2002 – 06 • Receive intensive hands-on training to master various basic and advanced research skills “The program inculcates a great deal of ability to do hard work, • Learn the basics of Good Laboratory Practices punctuality, sincerity, art of communication with professionals, feeling of responsibility and aptitude to work as team-member • Learn how to conduct a thorough literature review/ critical analysis of published research in fellows. The fellows will learn how to do multiple tasks • Develop superior communication and presentation skills simultaneously and efficiently.” Shyam Allamaneni, MD | 2003 – 04 • Participate actively in cutting-edge reproductive research • Develop a strong foundation in human reproduction, assisted reproduction and infertility “I was impressed by the systematic environment in the laboratory. • Learn the process of developing a novel scientific research idea Although I was unfamiliar with bench research at first, I was soon able to focus on my project without hesitation … The experiences • Learn the techniques of writing a scientific bench research proposal in the lab gave me a strong belief that if I had an idea, I could make anything possible in that setting.” • Master the art of writing high quality scientific articles Won Jun Choi, MD, PhD | 2004 – 05 • Publish research findings in top-tier scientific journals • Learn the fundamentals of research involving human subjects “I sincerely believe that the Center for Reproductive Medicine at the Cleveland Clinic helped me accomplish my short-term and long-term • Learn the basics of data management and biostatistical analysis goals. I would highly recommend this program for anyone who has • Learn to be an independent, confident and resourceful researcher a desire to learn and become successful in the world of academic medicine.” Deepinder Goyal, MD | 2006 – 07 Develop Valuable “Once I joined as Post Doctoral Research Fellow under the leadership of Dr. Agarwal at CCF, it was the beginning of the Research Skills new era in my academic career. And when I look back, it was Research & the stay at CCF which molded me or I should say prepared me as a Scientist in Biomedical field. Even after my tenure was • Scientific integrity and accountability Training Methods over at CCF, I am continuing as an academic collaborator with CRM, which has resulted in many collaborative publications in • Professionalism and leadership journals and as books. The program offers several learning opportunities in the • Discipline and time management • Personal mentorship approach with form of class room teachings every week by experts from multidisciplinary units of the CCF, a rich diversity of clinical cases, multitude of opportunities in both • Motivation and self-direction daily supervision clinical as well as basic research, interaction with students from across the globe, • Team work and collaboration • Practical demonstration and hands-on an easy access to latest literature, expert research guides and many more. It was really one of my best experiences in life. I do thank each and every member of CRM • Creativity and innovation training in laboratory techniques who have dedicated themselves for the betterment of biomedical research and • Organization and methodical planning • Weekly research meetings for project thereby quality outcome through the ones who are trained at CRM and are now serving the people in many countries.” planning and development • Effective interpersonal communication Alex C. Varghese, PhD | 2007 – 08 • On-site and online courses on various • Critical thinking and judgement research procedures “The lab at CRM was like my second home where every single moment • Problem solving and trouble shooting spent is like a golden memory. “Once a member of CRM, always a • Training in literature review strategies member of CRM”. Any fellow who joins the CRM develops an eternal and tools bond with the department. The huge amount of work I’ve learnt here is an invaluable asset for all times to come. Thank you CRM for believing • Training in writing of scientific articles in my capabilities and letting me accomplish all my dreams. I’m going for publication back home successful and with a wide smile on my face.” • Lectures and presentations Arozia Moazzam, MD, PhD | 2010 – 11 • Journal Club and group discussions 2 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 Testimonials from Research Alumni: “My overall experience was good. I gained a lot of experience and friends. I would like to thank Dr. Agarwal and CRM for everything they have done for me, it was a great experience - I learned a lot on a professional as well as a personal level.” Amani Shaman, MD | 2011 – 12 “I came to CRM looking for interaction with new research and to expand my ideas and knowledge. After a year, I have achieved my goals. I’m very thankful for all that Dr Agarwal, Dr Sharma and Dr Gupta have done for me, the teaching and the sharing of experiences. The program is of great value if you are looking to grow as a person and as a professional.” Helena Malvezzi, MSc | 2012 – 13 “I consider my experience to be successful. I am very happy with the outcome, given the unique circumstances of having a limited amount of time to spare for research due to my heavy clinical responsibilities.” Who can apply? John McGill, MD | 2012 – 13 Medical graduates, physicians, and scientists interested “I gained a lot of knowledge and skills in the field of male infertility. The year was very exciting and went by very fast. Honestly, I would in conducting cutting-edge bench research in the field of not have gained this level of knowledge anywhere else in a year’s duration. My deepest gratitude to Dr Agarwal for being a great Reproductive Medicine are welcome to apply. Applicants mentor and a real friend. I truly appreciate and value everything I are selected on a competitive basis from a pool of have learned from Dr Agarwal and his team. It will remain a major contributor behind my success and achievements.” candidates from around the world. Once approved, the Saad Alshahrani, MD | 2012 – 13 candidate is appointed as a Research Fellow through the “I have benefited tremendously from the time, effort, thought and care that went into my training. The one-on-one mentorship and Cleveland Clinic’s Graduate Medical Education Program. guidance was personalized to suit my strengths and weaknesses, and this truly made the difference. The great emphasis placed on personal growth made this a unique experience with a life-long impact.” How to apply Damayanthi Durairajanayagam, PhD | 2012 – 13 “Throughout my training, I received strong support from my mentors. They provided me with systematic training, very good suggestions When applying online, you will need: for improvement and prompt feedback. The Fellows worked as a team and supported each other in all our work. I will never forget my Recent curriculum vitae/resume experience here in CRM.” Cui Zhihong, MD | 2013 – 14 3 recent letters of recommendation from persons with first-hand knowledge of your work “I am sure that in no other lab in the world can a Fellow accomplish such a huge amount of work in such a short time. Copies of degrees/certificates, transcripts and TOEFL score The Andrology Center is our family in the US and I always felt Dr. Agarwal’s support and encouragement starting from the first day.” Copy of passport and a passport-sized photo Ahmet Ayaz, MSc (PhD student) | 2013 – 14 Proof of sponsorship/scholarship Address, telephone number, and Skype ID for a personal “This Fellowship has revealed my strengths and weaknesses - interview with the Director situations in which I shine and moments in which I flame out. Besides a valuable lesson on how to work hard and smart, I have learnt which features of mine I have to work on in order to become Apply NOW! a better scientist as well as person.” Eva Tvrda, MSc (PhD student) | 2013 – 14 A limited number of Fellowship positions are “I sincerely thank CRM for providing me with the chance to pursue my research project. I am also thankful to available every year. Dr. Sharma for his generous support and for taking the time to Only the most qualified applicants with a share his expertise and knowledge on my project. The training in the Andrology laboratory procedures was well organized and genuine desire to learn and engage in real research very satisfactory. The ART Training was very valuable to develop will be considered. technical expertise in ART techniques. The highly qualified and experienced trainers made the training more beneficial. The 2014 International candidates (scientists/physician Summer Internship Course was a great teaching experience to be a part of different training activities.” researchers) are welcome to apply. Testimonials Sezgin Gunes, PhD | 2014 Open call application process (no specific deadline). Testimonials For more information on applying for the 2015 Testimonials Research Fellowship, please click here. 3 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 Who We Are Ashok Agarwal, PhD, HCLD Rakesh Sharma, PhD Sajal Gupta, MD Edmund Sabanegh, MD Dr. Eric Klein (Chairman, Glickman Urological and Kidney Institute), Director, Center for Reproductive Medicine Associate Professor, Lerner College of Medicine Assistant Professor, Lerner College of Medicine Chairman, Department of Urology Director, Andrology Center Research Coordinator, Assistant Research Coordinator, Head Section of Male Infertility Dr. Edmund Sabanegh and Dr. Ashok Agarwal Professor, Lerner College of Medicine Center for Reproductive Medicine Center for Reproductive Medicine Professor, Lerner College of Medicine During their Fellowship year at CRM, our Research Fellows r• e cSienei Rrvveeep varosad lauu cMeti evanedt Modre/eAdddic vionispeo prh oedlrudtr uiannngni ttuhieaels lSy u tionm Jmpuaenrre t Maicneindpt Jaourtsleyh. iiCpn lpi carkong hdrae..mr.e GlickmTanh UerL oeCt lito bgle keincovawlne athlnatad nKdid nCeyl iInnisctitute Cen· ter Cfloerv eRlaenprdodCulicntiivce·M eedniic to read more about our Mentorship Program. Eva Tvrda, MSc • RcTsCeouelcimccchcekpnei vlisheqesteu efsreulyeyslsl yfttcro eoec mrueoe mraoastfpdei cc l ehm hateaeonlrd rdtge h ae cea nodibrnmu ouArupaiRntrl eTlgoyh u Tteirhrnna e AsiS nRAieviTdnpe vgt T h arawaanniincnldlde i rndOseg -ccR otPee.n irpFv oAreegoRl rldaaTou wmCTcrest.a i rvwitniefhiincogate. MDPAeirrSdoeHficectOisonsKreo, rACD, GeiDrnAeetcRcpetorWao rnrfto,Am drAL eRu,n nPdectprht oore.olDfod dUg. u yfrco oCtlriove gen1y th2 e“r0aS shp oseeurrrmvs edadut roainzs oga at hM Pe er2CJnoC0AReuot1tsnAoose4tnroKedir crESni ienfaSouoa tH rEnetm9 o RPS xr em trH–oaophfAfr e emeoR RrsdJ es MOuIsuiocennAr,tarl ,itarDv iyecPegerht hpiMn2i.naoDser5ha.tdnmi,ilc pe ii2Bnn nPete0 orTnfo1 Uceg4hrrsoat loiRmgcyeu asleta atrhr ecC hCa ePnnrCcAtAoSeeessnAsrjrstie Jise fsAtcProta Latfrnoan GtretR t RURnPieerPeetpospTniefrreAtaoostl,rds ecsdMuoh”ducr ,.tC D ciDvot.eeoi pvrMdaeire ntMdmaitceoeinrndte iocf iUnreo logy BOOKS PUBLISHED Glenn LU.n Secxhpalttaminaen,d S Iannfderrot Cil.i tEysteves, FNeornti-lIiznavtaisoinv:e N Sopveerlm C oSnecleecpttiso na nfodr M Ine tVhiotrdos StSrtersaste Dguiersin tgo AAsmsiesltieodra Rtee pOrxoidduactitvieo n MLiafeles tIynlefe artnidli tEy:n vAi rCoonmmpelnettea lG Fuaicdteo rtos Sperm ChAr oPmraacttiinc afol rG tuhied eC linician: Quality MAa nPargaecmticeanlt Ginu iAdReT Clinics: FeErmtileitryg iPnrge sTeecrvhantoiolong iine sM aanlde s: FerEtimliteyr gPirnegs eTervcahtnioonlo igni eFse amnadl es: APsuhTboalkibc lAaetg ioaofnr w CDaoalnt e(teE: nd2it0tso1r5s) AshoAkPm uAaTbganlaibdcralawe tS iaoo.l fn,S CEeDodtatnsit oet(enE: n d2Bti0tsoo1rrg5se)s Jr., AsGhuorkp rAiygaa rVwiPrakul,Tb, a GlDib.c,ala eSmt itooaefnyf aa CDnnoa tDnhtetuie : D Pn2ult0esra1ssi5riasj a(Endaiytaogrsa)m, SteEfdamn uSPn.u dTdb auSlib .cP laSeltea iosobsfna i CnsDe,oa gAntheste :hJ nr2o.t 0ks(1 EAd4gitaorrws)al, ArmPaunbdl iZciTanatii,bo Alnes Dhoaof tkCe :oA nAgatuegrnwutsastl 2(0Ed1i3tors) PubFliacbaAitosiolhaTno a BkDbe alAnetgte ooa:, fr N SwCoaaovnlne d(tmreEobnd Eeittsrso tr1es3v),e 2s,012 EPmurbel CiSclaeitlnTii,oai nAcb salDehla ooAtkefp :CA pOoglcnaitctroewabneattirlso 5(nE, sd2i0to1r2s) EPmurbel CiSclaeitlnTii,oai nAcb salDehla ooAtkefp :CA pOoglcnaitctroewabneattirlso 5(nE, sd2i0to1r2s) UnPdrearcsttiacnesd ianngd M Inadlei aInn fPeretrisliptye cGtliovbeal Antiofoxrid Calnintsic iina nMsa alen dIn Rfeersteilaitryc:h Ae rGsuide BLuaiblodrinagto aryn:d A M Parnaacgtiicnagl aGnu iIdVeF Clinical EmbZrsyooltl oPgeyte:r AN aPgrya,ctical Guide (OxSidtautdiviees S otnre Wsso mine Anp’sp lHieeda lBthasic ClinMicaalel AInpfperrotialicthy:e Cs,o Anntedmroploogray,r yA RT PrAadcvtaicnacle Md aMneutahlo odfs I na nVdit rNoo vFeelr tDileizvaicteiosn: St(uOdxiiedsa toinve M Setnre’ss sH eina lAtph palniedd F Bearstiilcit y Sonia MPaulTibkal,ib cAlaest hiooofn k CD Aoagntaete:r nw2t0as1l 4(Editors) SijoP PuabrlieckaatTtioatinbl, lDAeas ohtefo :Ck No Aongvteaemnrwtbsaelr (2E0d1it3ors) Alex CP. uVbalrigchaTeZtaissoboenll,e t D A Poasefth teCeo:or kO nN Actaetgognabytr,eswr a2l0 (1E3ditors) Alex CP. uVbalrigchaTetaisobenl,e D Aoasfth eCo:o kOn Actetgonabtreswr a2l0 (1E3ditors) RePsuebAalsirchcaBohtoki ot arnAon gsDda aRr tCwiezl:ka i Aln(,Eu iNcdgauiatbsolit rl Ps 1A)r,z a2izc0, t1i2ce) Sijo J.P PuabrleickaTa&attit boiAlln,en AD tosiafoh tCeox:iko dJ nAuatgnenaent rts7ws, a2l0 (1E2ditors) ZsPoulbtA lPiscehatTetoairkob nN lA eaDg goaayftr, e wCA: aolAelnpx (t reECilnd. 2itVts4oa,rr sg2)h0e1s2e, RAePssuheboalkiJrc uAcaagthniao arnGw n.D aAdall tv,C eaR:lr oieMnbzeai (crrEtca dhJloi t1hPo7nrrs, a A)2ci0tkt1iec2ne,) Table of Contents Table of Contents Gamete Assessment, Selection and Male Infertility for the Clinician: Medical and Surgical Management Sperm Chromatin for the Researcher: Micromanipulation in ART A Practical Guide of Male Infertility A Practical Guide A Workbook on Human Spermatozoa Fertility Preservation: Emerging Sperm Chromatin: Biological and Andrology Laboratory Manual Alex CP. uVbalrigchaTeZtaissoboenll,e t DA Poasefth teCeo:or kO nN Actaetgognabytr,eswr a2l0 (1E3ditors) Sijo J. PPuabrleickTaaattitboilln,e A Dosafh tCoe:ko nAAtugeganurtswst a2l0 (1E3ditors) AshokP uAbBglaioctrarwotTisaoa lnRb, MElDedaB mot eRfu :iC nzSokde,n p SNtteaeanbmbatisbln eAergz hi2z 0,( 1E3d it o r s) ArPmuabnlidc aZtiTinoain,b AlDesa hoteof :kC S oAengpatteernwmtasble (r E2d0it1o3rs) SonPiauabn Mldica aAlTitkasio,bs nAli essD htaoeotfde kC: AoCFgneoatbnerrncwuateasrply ( t2Eio0dn1it2ors) TechPnEumbolliroceag StiieeolnTsi,a DAabaslnethde oo: kCfS CeAlipogntnaeitrcmewanbalte lsA r( p2Ed3pi,lt io2cr0sa1)t1ions ClinAicrmaPaualn bnAdldip c AZpasitnlisioic,in saA Dtsteihaodtoen k:Rs AAe iugpngar urMowsdtaa 4ull ,ec( 2E tIid0noi1tfno1errst)ility PuKbalimcaintMiioT SnAa b.SD Rlraeiant ooeiv,:f a AFCseso b(hnErotudekaint rAotyrgs s1a)0rw, 2a0l,1 0 Table of Contents 4 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 Research Collaborators & International Faculty The Center for Reproductive Medicine has collaborative relationships with many highly esteemed scientists and clinicians from over 18 countries around the world. Some of our renowned collaborators include: Dolores Lamb, PhD Botros Rizk, MD, PhD Sijo Parekattil, MD Sandro Esteves, MD, PhD Mourad Assidi, PhD Mohamed Arafa, MD, PhD Haitham Elbardisi, MD Houston, Texas Mobile, Alabama Clermont, Florida Campinas, Brazil Jeddah, Saudi Arabia Doha, Qatar Doha, Qatar Laura Sirot, PhD Muhammad Abu-Elmagd, PhD Stefan du Plessis, PhD Damayanthi Walter Cardona Maya, PhD Sheryl Homa, PhD Rima Dada, MD, PhD Wooster, Ohio Jeddah, Saudi Arabia Tygerberg, S. Africa Durairajanayagam, PhD Medellín, Colombia London, United Kingdom New Delhi, India Kuala Lumpur, Malaysia Giancarlo Balercia, MD Philip Kumanov, MD Peter Nagy, MD, PhD Ramadan Abdou Saleh, MD Jaime Gosálvez, PhD Nabil Aziz, FRCOG, MD Rajender Singh, PhD Ancona, Italy Sofia, Bulgaria Atlanta, Georgia Sohag, Egypt Madrid, Spain Liverpool, United Kingdom Lucknow, India Uwe Paasch, MD, PhD Sonja Grunewald, MD Diana Vaamonde, PhD Juan Alvarez, MD, PhD John Aitken, PhD, DSc Suresh C Sikka, PhD Armand Zini, MD, FRCS(C) Liepzig, Germany Liepzig, Germany Cordoba, Spain Barcelona, Spain Newcastle, Australia New Orleans, Louisiana Montreal, Canada Other Important Information Applicants should keep in mind that: • All appointments for Research Fellowship are for a minimum of 1 year and there is no financial support available. • Candidates must have independent funds such as a private or government scholarship to support living expenses in the United States. • Research appointments do not result in the award of a degree; successful completion of training results in the award of a Certificate of Research Training from CRM. • Candidates registered with their parent institutions/medical schools for a Master’s/PhD/MD degree can select the Cleveland Clinic for their research studies requirements. Research findings, once completed in our Center, can be submitted towards fulfillment of a degree from the candidate’s own institution. Anthony J Thomas Jr, MD | Retired Urologist, Head, Section of Male Infertility, Cleveland Clinic 5 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 The program continues to provide cutting edge knowledge, experience and appreciation for research with professionalism, integrity and humility. Research Overview Kim Dao Ly, BS, MBA, Final Yr Med Student, USA Alumni, 2010 Oxidative Stress and Infertility Why Proteomics? The foremost goal of the Cleveland Clinic’s Center for ♦Examination of sperm function through proteomics will Reproductive Medicine is to better understand the causes of improve on conventional semen analysis in the workup of male infertility, to design studies aimed at improving semen male infertility. quality, and to comprehend the underlying mechanism of male infertility associated with various clinical etiologies. Over the last 2 decades (1993 – 2014), CRM has established itself as a leading laboratory in human infertility research, and particularly in the field of oxidative stress and infertility. CRM Faculty and Researchers have published over 200 key articles in this field and is dedicated to disseminating its results. Many of these studies continue to be cited today. For a publication and citation report from the Scopus database, please click here. Proteomics – Our Current Research Focus While semen analysis remains a cornerstone of laboratory investigation for male infertility, a routine semen analysis alone does not provide information on the underlying Transcriptional regulatory network showing interactions between differentially molecular alterations in the seminal ejaculates of infertile expressed ROS + proteins and androgen receptor. men. Oxidative stress can affect sperm function and result ♦Identification of sperm specific proteins via proteomics in modification of proteins in the spermatozoa. would provide a further understanding of their function Proteomics involves careful analysis of proteins expressed pertaining to fertility in the male. by a cell or tissue during a particular given state. The ♦The developing field of sperm proteomics has the further study of protein expression has been the subject of intense advance potential to our knowledge of the numerous research for many diseases during the past decade, with cellular pathways necessary for sperm function and to much interest devoted to reproductive implications. At help identify those with the greatest biological present, more than 6,000 discrete proteins have been significance in men suffering from infertility. identified in semen, which represents about three quarters of the entire sperm proteome. ♦Proteomics holds the key to Proteins are of significant importance in cellular remodeling the development events and aberrant expression could lead to marked of novel defects in sperm function. In cases of those diagnosed diagnostic and with male infertility, differential proteomics may be utilized prognostic to study the alteration in protein expression of either the protein spermatozoa or seminal plasma of these men. biomarkers for The goal of our the evaluation proteomics studies of infertile men Venn diagram showing distribution of 20 differentially expressed is to identify by comparing the proteins. This was based on the NSC (normalized spectral counts) ratio cut-off >2 across 3 samples: NA (normal sperm count proteins that differential and abnormal morphology), OA (oligozoospermia and abnormal may be altered expression of morphology), and ON (oligozoospermia and normal morphology) in or differentially sperm and comparison to the baseline NN (normal sperm count and normal morphology) sample. expressed in a seminal plasma given patient proteins in fertile vs. infertile men. population that can ♦The combined application of proteomics and serve as potential bioinformatics tools can identify major alterations in biomarkers in the proteins involved in various clinical diagnosis of the etiology of male infertility. infertility. cAMP Responsive Element Modulator (CREM) signaling in the testis. 6 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 I truly appreciate the opportunity to participate in such an excellent research program and to have so many life changing experiences with such incredible people. Research Overview Sejal Doshi, BS, Final Yr Med Student, USA Alumni 2012, 2013 How Proteomics Studies Work Proteomics and Beyond ♦• Proteins in spermatozoa or seminal plasma samples are Our recent proteomics research has demonstrated differential separated into peptides, and their expression quantified protein expression over controls in a variety of situations that and subsequently identified using gel electrophoresis include idiopathic male followed by a liquid chromatography – tandem mass infertility, varicocele, spectrometry approach. azoospermia and assisted reproductive ♦• Further identification technology failure. of proteins separated This early work allows by LC-MS/MS can be the development of achieved using Mascot methods to study male and Sequest programs. infertility, which was Furthermore, previously believed differentially affected to be idiopathic, and processes, pathways ultimately to stratify and cellular distribution Biochemical pathway proposed to regulate sperm interventions based on as well as protein capacitation and hyperactivation. laboratory results. protein interactions can be identified via the A list of our recent proteomic publications is featured on pages use of available 8-9. Through these preliminary studies, we have established functional bioinformatics a platform to utilize proteomic tools to unravel the underlying analysis such as Gene mechanisms of Ontology (GO these etiologies annotations and of male infertility. Extraction and analysis process of proteins from spermatozoa. proprietary software Results of these packages such as Ingenuity Pathway Analysis (IPA). proteomics studies could eventually lead ♦• The potential proteins that have been identified as to the identification differentially expressed are further validated by Western of appropriate Blot, ELISA or immunohistochemistry to identify the antioxidant therapy biomarker status of the proteins in various pathological to alleviate oxidative conditions attributed to oxidative stress or in patients with stress-related other etiologies. infertility. ♦• Differentially expressed proteins present in infertile men While we continue to with a particular diagnosis that are involved in sperm rely on conventional function, sperm motility and other functions related semen parameters to reproduction may serve as novel biomarkers in the in the evaluation of identification of that certain disease. the subfertile male, ♦• These biomarkers may help urologists identify better proteomic analysis options for clinical management of infertile men. Intrinsic and extrinsic pathways of apoptosis of the holds great promise as hyperthermic spermatozoa. a diagnostic tool in the reproductive medicine armamentarium. With the identification of novel biomarkers through proteomic studies, clinical tests and treatments for sperm dysfunction may be developed to potentially help infertile couples. 2014 Key Publications from CRM In addition to proteomics studies, a selection of highly cited articles and other recent important studies published by our Center is featured on pages 10-14. For a comprehensive list of our research publications in the ResearchGate database, please click here. 7 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 The combination of things I learned at the program truly makes it a unique program. It is multi-faceted and thus a valuable asset to any career path. Research Overview Julia Tsinberg, BS, USA Alumni 2014 Selected Research on Proteomics and Infertility Published by Our Center 1 2 3 4 du Plessis SS, Kashou AH, Benjamin DJ, Yadav SP, Agarwal A. Thacker S, Yadav SP, Sharma RK, Kashou A, Willard B, Hamada A, Sharma R, du Plessis SS, Willard B, Yadav SP, Sharma R, Agarwal A, Mohanty G, Jesudasan R, Gopalan B, Reprod Biol Endocrinol. 2011 Mar 22; 9:36. doi: Zhang D, Agarwal A. Sabanegh E, Agarwal A. Willard B, Yadav SP, Sabanegh E. 10.1186/1477-7827-9-36. Review. Fertil Steril. 2011 Jun 30; 95(8):2745-8. doi: 10.1016/j. Fertil Steril. 2013 Apr; 99(5):1216-1226.e2. doi: 10.1016/j. Reprod Biol Endocrinol. 2013 May 11; 11:38. PMID: 21426553 IF: 2.41 fertnstert.2011.03.112. Review. fertnstert.2012.11.046. doi: 10.1186/1477-7827-11-38. PMID: 21536282 IF: 4.295 PMID: 23312230 IF: 4.295 PMID: 23663294 IF: 2.41 Our Research Collaborators LDeiBrrenecleitrno Rdr, aePs rWeoatielrlcoahmr dIinc, ssP tChitoDurtee DirectSoerr Bovafic nBePuisol ,aGi nYnoofoopr,rga mT lCeaaoxntari,pcs Pso rhCaDotinosnu lting SeJneCiflofe rvH Bealiamonsmtda,et iOls,h tMiicoSian ManagerE, CdAMulmeecvydae itMcliaoaonnl o dEIrn dCesi,ltti iinBntuigAct eS ervices, DChaesee pWMae oBCsltelaeeclrvaunesl alRuarebn Gsrdeae,r nmOveehat iinUcoiinsaitnve, rPshitDy DDiPriAerreocScftHeotosrO,sr ,KoA Cr n,Ae dDnGreotAeploRra gfWroytm rAL ReLaneb, ptoP rrohoafd. tDUouTr.cry,hot ilHevo eCg1I yn2LMD mewdoiictnnitGnhee s f&sel llwowiFthMhosechrerCei aCpkoeChAo nRfisr,oetnes AerrmtnccodraKh l ciuwntfnEihioeaddsaSrotre teHRpco s ar f1:eru Pek oS rpboprt HTorn9frlaai oif AfRcerCRdis,t sRZecpuih s e csaM“cro2oieUpettprRhaAnis,evrah r0e ,gDeecotn i PqihssetMdo1r pahieinaenueat.a 3DiowgdrThicortni.,mntcac hi ioC –hlnrevooridnhefie sCo gteFir M niedoMcennsaf lega etUlearlhoa dtrrgbiociwliseihfrlocn i ”c1geccifc in y9haniCha nedttrhee,i v nd s lACe1giaasnsu ylr. a9deecCp hAoverAri,,sfnenSo e ss wtlMl,As2isleasiroJrest ia Anadat0tngfaoinrMLndyntcrt 1 geGth /RR CdnUPU,oeKe4 r fpsP2lo rtersiDfT0oooaecnAddi1rs:lieci,uso4 nchocMdgt. rt,iCi .y fvDDioec noC.e aMrpdraeitnreidtcamillcteoyiesnrin et n oIf Unircolsogytitute · C enCtleer vfeolar nRde pCrloidniuccti·v e eMniecid 5 6 7 8 ReproductiveBioMedicineOnline(2014)29,32–58 wwwww.ws.cribemncoendliirneec.tc.ocmom REVIEW Proteomics,oxidativestressandmale infertility AshokAgarwala,*,DamayanthiDurairajanayagama,b,JacquesHalabia, JasonPenga,MonicaVazquez-Levinc NM*aaCCAtoeRirnoAretnesUaprlnoifRnvodeerisrneRsgaietarpyucrthoohfdoCruTo.cuetncEihvc-meinloaMolilofeagdAdyird,cgriSeneusnesnt,:giGnaagaliai,cBrkwCumOaloaNah@nI,CcUcESfeTr.ool,arlBogngug(iAoecrnaA,olgsMaarAnawdliaarleyK)s.si,dianA;ercygeIInnnsstttiinittauuttee,oCflBeivoelolagnyda,nOdHE,xUpSeAri;mbeFnatcaullMtyeodficMineed,icine, AtHeotimhodfseeohipmtlohrAsoooka,rnlvsiAedaaincgrlrsoeugablwslrooamweeagraaarlymrldllceCisaahserfsoeankefdeftrPseetrereisrrloxvtioaftiteleyfenir.tsndaoyslsxoDikivprdieerraaeyelttycsijtevtohooeruenvrrsanLototreafixeolrRissnndeseia,nsritenDihCvaNuoerpAmclalhsetfatirganreaeetngrstoetmsshfpeearMwnonCetiddtadeuhtniiccittotcsieninaoreinmnaf,c.nopCedrAlaris,RacsheeapaoptoWnkirpod’oetsndosstctushueicoesrrtnrnuieevsRhnefiufinetMmgscreaeeparcdsrnveyioecatfiorUeencforenhtm,icivlieCiienctrlrtytessea.viartieeHnnylsdeaatansnbnsddiaetorirCtioevnhlxeifetnioshdiHrceaome,nnsaatUtdstutSihdAocienysf. emcapmft(sªAceophiaabmaaarea2srssrylreer0tretibmroands1raoaeicf4alnaacwhstt,tstfnteseyhiseoRdtdrrorerzehirectzOppopapiseitrealrxatprihooreittteoaodtodyehsenmssaux.deeeistciEwnnereiptwevawttisereveacidolirteaxbhltoehtspnhoxeaHvtodrilirisinepefinneestafhsi.twsmoensplhysCtirrse)horisthhoisesceniaoaafileagmntelnslioroudesngeimgbltnseassuiesLaucesttoedetrolamnfdimiennrle.p.smsyiscleIepsnPatoapmshrausrnrtroaaemlbeaiicttsnzslpbsheeaipeassullwinohaulinlpcsttesngaerhruscmdgsyojaeroeafesttradbrn,scesieoyo.tcuoawnameneFlEnmstahdsnuldtshfiioettol/ceeinruensfoagvaerdfihnoratfereiirdfolonsrcotesimpfgmoendtLeseunrtstaearmhddrcotimnate.neieneiednoaAdnsbmspitntleicilrarsowoasamoahgrzimliiittnonsoitngein,hauoaohcoasrls.tntaddmkploessIuiepednfiriosbnrcrfleeasemfewrcsssseretlofitmuetcrtrfpoueedvhneafrodreeetnoxiimdsteutdcraia.edsnaliasymoiiaddslnenppeetpieiaseciacslrvriraseatwnssefmhltls,foseaiescrwceprnatrmoenrrtindinotetinedmlhdtstfidoestihesootfy,oueriisxnpotamptaiiaolnmdplnmyieissacrtdot,teeaty-inaisshn.sotvgnsusraleeowRaoacstBdcnghlMshiybOittyseaasnarhlelmieaentnoseeehtsstfnhisidaioohgoircginxahtxemohoaividdonDpleomaxadJlmxinbiti-cediti1toedavita,odeaapettnPientboifivissIdotvPtcpeelwera,ieinencsterlststiaftriromrsocareee-nertliass,nsrmospsnesdtwioye.lncruanhadoTdcttsinmeehhicetssddeehos--- KEYWORDS:biomarkers,maleinfertility,proteomics,oxidativestress,seminalplasma,spermatozoa h14tt7p2:-/6/4d8x3./dªoi.2o0r1g4/,10R.e1p0r1o6d/ujc.rtbivmeoH.2e0a1lt4h.c0a2r.e01L3td.PublishedbyElsevierLtd.Allrightsreserved. Sharma R, Agarwal A, Mohanty G, Hamada AJ, Gopalan B, Sharma R, Agarwal A, Mohanty G, Du Plessis SS, Agarwal A, Durairajanayagam D, Halabi J, Peng J, Gupta S, Ghulmiyyah J, Sharma R, Halabi J, Agarwal A. Willard B, Yadav S, du Plessis S. Gopalan B, Willard B, Yadav SP, Sabanegh E. Vazquez-Levin M. Biomed Res Int. 2014; 2014:916212. doi: Reprod Biol Endocrinol. 2013 May 20; 11:48. doi: Reprod Biol Endocrinol. 2013 Sep 3; 11:85. doi: Reprod Biomed Online. 2014 Jul; 29(1):32-58. doi: 10.1155/2014/916212. Review. 10.1186/1477-7827-11-48. 10.1186/1477-7827-11-85. 10.1016/j.rbmo.2014.02.013. Review. PMID: 24900998 IF: 2.706 PMID: 23688036 IF: 2.41 PMID: 24004880 IF: 2.41 PMID: 24813754 IF: 2.682 8 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 This has been one of the most significant experiences of my life not only for the knowledge and professional advancement it helped facilitate but also for the great times I had with the staff Research Overview and my peers. Stephen Bowen, BS, USA Alumni 2013 Selected Research on Proteomics and Infertility Published by Our Center 9 ARTICLES 2 in Press 1 Major protein alterations in Differential proteomic profiling of spermatozoa from infertile men with spermatozoa proteins of infertile unilateral varicocele. Agarwal A, Sharma R, Durairajanayagam D, men with unilateral or bilateral varicocele. Ayaz A, Cui Z, Willarb B, Gopalan B, Sabanegh E. Agarwal A, Sharma R, Durairajanayagam D, Ayaz A, Reproductive Biology and Endocrinology (In Press) Cui Z, Willarb B, Gopalan B, Sabanegh E. IF=2.41 5 Urology (In Press) IF=2.132 Impact of precise modulation of 3 reactive oxygen species levels on 4 spermatozoa proteins in infertile men. Ayaz A, Agarwal A, Sharma R, Spermatozoa protein alterations in Arafa M, Elbardisi H, Cui Z. infertile men with bilateral varicocele. Proteomic analysis of mature Clinical Proteomics (In Press) Agarwal A, Sharma R, Durairajanayagam D, Ayaz A, and immature ejaculated IF=3.43 Cui Z, Willarb B, Gopalan B, Sabanegh E. spermatozoa from fertile men. Asian Journal of Andrology (In Press) Barazani Y, Agarwal A, Sabanegh ES Jr. IF=2.530 Cui Z, Sharma R, Agarwal A. Urology. 2014 Aug; 84(2):255-61. doi: 10.1016/j. Asian Journal of Andrology (Under Review) IF=2.530 urology.2014.04.043. Review. PMID: 25065986 IF: 2.132 Collaborating Research Alumni Meet Our Research Staff Rakesh Sharma, PhD | Associate Professor and Research Coordinator Rakesh Sharma is an Associate Professor at the Lerner College of Medicine of Case Western Reserve University and is the Coordinator of the Andrology Center and the Center for Reproductive Medicine. Dr. Sharma has published over 200 scientific papers in peer-reviewed scientific journals, authored 30 book Tamer M Said, MD, PhD Sandro Esteves, MD, PhD Alex Varghese, PhD Ramadan Abdou Saleh, MD chapters, and presented over 360 abstracts at both national and international Toronto, Canada Campinas, Brazil Kerala, India Sohag, Egypt scientific meetings. He is an investigator on 55 research grants. Dr. Sharma is a recipient of the American Foundation for Urologic Disease (AFUD) Fellow Award, Merlyn F. Bumpus Junior Investigator Award, Research Excellence Award, Research Fellow of the Year Award, Mentor Recognition Award, [email protected] Scientist of the Year Award, Excellence in Male Infertility Research Award and +1.216.444.8182 the 2012 Star Award from the American Society for Reproductive Medicine. Dr. Sharma’s current research interests include the role of free radicals in the pathophysiology of male and female infertility, oxidative stress and DNA Rachel Jesudasan, PhD Arozia Moazzam, MD, PhD Alaa Hamada, MD Reecha Sharma, MD, MS integrity, alterations in oxidative stress-related proteins, sperm proteomics Hyderabad, India Lahore, Pakistan Boston, MA Philadelphia, PA apoptosis, fertility preservation and endometriosis-associated infertility. Sajal Gupta, MD, MS, TS (ABB) | Assistant Professor and Assistant Research Coordinator Sajal Gupta is an Assistant Professor of Surgery at the Lerner College of Medicine of Case Western Reserve University and is the Supervisor of the Andrology Center and Assistant Coordinator of Research at the Center for Reproductive Medicine. She obtained a Masters in Clinical Embryology and Andrology from The Jones Saad Alshahrani, MD Damayanthi Cui Zhihong, MD Eva Tvrda, PhD Institute for Reproductive Medicine in Virginia. Dr. Gupta has published over Al-Kharj, Saudi Arabia Durairajanayagam, PhD Chongqing, China Nitra, Slovak Republic Kuala Lumpur, Malaysia 60 reviews and research articles in peer-reviewed scientific journals, authored a dozen book chapters and presented about 55 abstracts at both national and international scientific meetings. She is an investigator on 18 research grants. Dr. Gupta is a recipient of the Award for Highest Productivity in Female Infertility To read more about our collaborators, [email protected] Research, Research Fellow of the Year Award, and Award for Excellence in Female +1.216.444.8182 please click here Infertility Research. Her current research interests include the role of free radicals in male and female infertility, endometriosis, assisted reproductive techniques and gamete cryobiology. Ahmet Ayaz, PhD Sezgin Gunes, PhD Istanbul, Turkey Samsun, Turkey 9 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015 The experience at CRM taught me to think analytically and solve problems quickly, while encouraging me to present new ideas to a consistently receptive and welcoming research team. Research Overview Aditi Mulgund, BS, MPH, Final Yr Med Student, USA Alumni 2013-2014 20 Most Cited Articles Published by Our Center 1 2 3 4 Agarwal A, Saleh RA, Bedaiwy MA Sharma RK, Agarwal A Agarwal A, Gupta S, Sharma RK Agarwal A, Said TM Fertil Steril. 2003 Apr; 79(4):829-43. Urology. 1996 Dec; 48(6):835-50. Review. Reprod Biol Endocrinol 2005 Jul 14; 3(28):1-21. Review. Human Reproduction Update 2003 Jul-Aug; 9(4):331-45. PMID: 12749418 Citation count: 801 PMID: 8973665 Citation count: 656 PMID: 16018814 Citation count: 636 PMID: 12926527 Citation count: 509 Fellows in Andrology with Highest Research Productivity 1 2 3 4 5 6 Tamer M. Said, MD, PhD Sandro C. Esteves, MD, PhD Fabio F. Pasqualotto, MD, PhD Reda Z. Mahfouz, MD, PhD Shyam Sunder Rao Allamaneni, MD Jorge Hallak, MD, PhD Toronto, Canada Campinas, Brazil Caxias do Sul, Brazil Cleveland, Ohio, USA Cincinnati, Ohio, USA São Paulo, Brazil Alumni 2002-06 Alumni 1995-96 Alumni 1998-99 Alumni 2006-2010 Alumni 2003-04 Alumni 1996-98 [email protected] [email protected] [email protected] [email protected] [email protected] [email protected] Publications with CRM: 28* Publications with CRM: 23* Publications with CRM: 19* Publications with CRM: 19* Publications with CRM: 18* Publications with CRM: 18* *These publications include only peer-reviewed, PubMed-indexed research articles that were either published during the Fellow’s stint at Cleveland Clinic or subsequently in collaboration with CRM Faculty (search date Jan 30, 2015). For a comprehensive list of publications of these alumni with CRM, click here. 5 6 7 8 Agarwal A, Makker K, Sharma R Saleh RA, Agarwal A Bedaiwy MA, Falcone T, Sharma RK, Goldberg JM, Attaran M, Agarwal A, Nallella KP, Allamaneni SSR, Said TM Am J Reprod Immunol. 2008 Jan; 59(1):2-11. Review. J Androl. 2002 Nov-Dec; 23(6):737-52. Nelson DR, Agarwal A Hum Reprod.2002 Feb; 17(2):426-31. Reprod Biomed Online. 2004 Jun; 8(6):616-27. Review. PMID: 18154591 Citation count: 375 PMID: 12399514 Citation count: 374 PMID: 11821289 Citation count: 331 PMID: 15169573 Citation count: 309 10 | Cleveland Clinic Center for Reproductive Medicine Research Fellowship Brochure Published on: Feb 20, 2015

Description:
male infertility and andrology have to be credited to the opportunity of being a Fellow at CRM. I truly believe that this is the best research fellowship program in reproductive medicine currently available INTRODUCTION. For most
See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.