ebook img

Empirical estimates of reproductive isolation among the Physa species of South Carolina (Gastropoda: Pulmonata: Basommatophora) PDF

2009·4.3 MB·English
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Empirical estimates of reproductive isolation among the Physa species of South Carolina (Gastropoda: Pulmonata: Basommatophora)

THE NAUTILUS 123(4):276-2S1, 2009 Page 276 Empirical estimates of reproductive isolation among the Physa species of South Carolina (Gastropoda: Pnlmonata: Basommatophora) Robert T. Dillon, Jr. Department of Biology College ofCharleston Charleston, SC 29424 USA [email protected] ABSTRACT VVethington, 1992; Wetlhngton and Dillon, 1991; 1993; 1996; 1997). But despite great advances in onr under- Previously pnblislied intDNA sequence data have suggested standing of broad aspects oftheir reproductive biology, thatan undescribedspecies ofPin/sa (“Species A”) mayinhabit progress in disentangling the complex evolutionary rela- the swamps and ditches in the southeastern Atlantic coastal plain. These snails arecharacterizedbyslendershells and dark tionsliips within the family Physidae has been slow. bodies, but are othenvise similar to the more widely The classification system of George Te (1978; 1980) distributed P. pomilia. Mate choice tests revealed significant recognized about 40 species and subspecies ofphysids in sexual isolation beUveen Species A and P. pomilia, with homo- North America, arranged into genera and snbgenera by gametic pairings of P. pomilia five times more frequent than penial anatomy. Within the group of nominal species heterogametic. A set of no-choice outcross e.xperiments bearing the penial complex Te characterized as “type-b,” )delded only self-fertilized progeny from the Species A parent however, Dillon and Wethington (2006a) reported no re- and reproductive failure from the pomilia parent, suggesting productive isolation among P. gifrina (Say, 1821), and five gsceponemecptilieecsatleolfySPspJieumjcisilaeasrintAhoabSxiptepiconimgeislSioAautbhhuytbCrabireodalriisnnaNa,aabdPi.ilistat)ci’un,cttaTi,vheeispemtnhoiirareld o1t8h25e)r,mPo.raeurreeace(nLtelay,d1e8s3c8r)i,bPe.dmsipcercoisetsi:iaPf.aan(cCihUaamrbiearl(Saaiyn, anatomy. Mate choice tests uncovered no evidence of sexual and Beny, 1930), P. parkeii (Currier in DeCamp, 1881), isolation betxveen Species A and P. acuta, and hybridization and P. utahensis (Clench, 1925). The addition ofP. sai/i occurred readily, wath some reduction in parental fecundit)' (Tappan, 1838) to the list oftype-b s)aronyms ofP. gifrina but normal FI \iabilih’. Species A x acuta FI hybrids appear, was suggested by the suix/ey of genetic variation at however, to be 100% sterile. Thus, the relationship between allozxane-encoding loci offered by Dillon andWethington the degree of reproductive isolation and genetic divergence (200(3b). seems to be stronger than that betAveen reproductive isolation In the group of physids bearing Te’s “penial complex and penial anatomy in the physic! snails of South Carolina. t)qae-c,” Dillon et al. (2002) could find no reproductive Plii/sa Species Awarrants formal description. isolation among P. Integra (Haldeman 1841) from the Additional kei/tcords: Speciation, Plu/sella. Plu/sa acuta, Phi/sa American northeast, P. heterosfropha (Say, 1817) from pomilia, mate choice, sexual isolation, hybridization, allozx’ine the American southeast, or the cosmopolitan P. acuta electrophoresis (Drapainaud, 1805), described from Europe prior to any American species of physid. Plufsa cubensis (Pfeiffer, 1839), from the Caribbean, and P. virgata (Gonld, 1855), from the American West, have also re- INTRODUCTION cently been synonymized under P. acuta (Paraense & Pointier, 2003; Dillon et ah, 2005). Reproductive isola- III recentyears, agreat deal ofinteresthas focused on the tion is complete, however, between physids bearing evolutionarybiologyoffreshwaterpnhnonate snails in the Upe-b and t>pe-c penial complexes (Dillon et ah, 2004). hunilyPhysidae (Tsitrone et ah, 2003; Bons.setet ah, 2004; Te also recognized a group wath penial anatomy inter- lernyet ah, 2005; 2006; Escobaret ah, 2007). Theirgreat mediate between t)pe-b and t)qre-c. These “type-bc” I reproductive pla.sticity, which includes selfing, ini.xed- species included P. hcndersoni (Clench, 1925), originally inating, and outcrossing in either or both sexual roles, described as a subspecies ol P. pomilia (Conrad, 1834). together wath their ease ofculture and the availability of But since Te’s obsenaitions suggested to him that genetic markers, has made physic! snails a favorite model P. pomilia bore t\pe-c penial morphology, he lowered lor the study o( sex allocation generally (Dillon and pomilia to snbspecific status under P. Iietcrostropha and K. T. Dillon, 2009 Page 277 raised hendersoni to the rank ol'species. More thorongh lonnd line "S” was collectetl Irom the spring by Huger obsemitions and experiments liave coidinnetl, however, Creek at Huger Lauding, 4 km N of Huger, Berkeley that topop-iric F. pomilia hear penial anatomy t)/^re-l)c, County, Sontii Carolina (33.1305°N; 79.81il°W). and that they are not reprodnctively isolated from All snails were culturetl in transjrarent polyethylene P. hendersoni, a junior svmonvm (Dillon et ah, 2007), 10 ounce drinking cups lilled with appro.ximately Recentlyanewclassification liasbeenproposedsynthe- 210 ml of aerated, filtered pond water and covered \\4th sizing lahoratoiy e.xperiments on reproductive isolation a 95 X 15 mm polysWrene Petri dish lid. They were led togetherwith mtDNAsequencedivergence and morphol- O.S.I. Spirulina Aquarium Elake Pood, sold iu pet stores ogical ohseiwations (Wethington, 2004; Wethington and primarily as a diet lor herbivorous aquarium fishes. All Lydeard, 2007). This classification recognizes approxi- experiments took place at I'oom temperature, approxi- mately 12 North American species anddocmnents aloose mately 23°C. I initially isolated ten wild-collected snails correspondence between mtDNA seipience pliylogronps from each study population in separate cups, collected andTes penial moq^hologies as outlined abo\e. egg masses with weekly water change, ami reared the mm In addition, the sequence tlata ol Wethington and olfspring to 2 shell length, approximately 3 weeks Lvdeard suggests that a previously unrecognized species post-hatching (well iu advance ol maturity). These three ol P/n/.SYZ, characterized by a dark body and elongated sets ol wild-collected but laboratoiw born sibships were shell, might inhabit the swamps and ditches of the tlesignated Al through AlO, SI through SIO, and HI southeastern coastal plain. This species, bearing tlie through HIO. Prom these sibships were drawn isolates t\pe-bc penial anatomy of P. pomilia but genetically for the mate choice tests and pairs of parents for the more similar to P. acuta, was referred to as "Phpsa Spe- study of postzygotic reproductive isolation. cies A”. The purpose ol the present paper is to report Eor mate choice tests, large samples of juvenile snails the results ol e.xperiments designed to test for reproduc- from all three populations were reared to maturih' over tive isolation behveen Pht/sa Species A and populations the course ol 8—10 weeks isolated in individual cups, of the two other physids occurring in South Carolina, \rith weekly feeding and water change. Two experiments P. acuta (Rpe-c) and P. pomilia (t\pe-bc). were performed: one comparing Species A to R acuta The origin and evolution of reproilnctive isolation has and the other comparing Species A to P. pomilia. Each been the subject ofintense interest since the earlytwen- e.xperiment was composed ol three trials, each trial in- tieth-centmw birth of the Alodern Synthesis (Vlayr, volving 10 adult snails from one population andten adult 1942; 1963). The barriers that may evolve beRveen a snails from a second, all approximately matching in their pair ol populations are conventionally di\4ded into pre- shell sizes. Snails were blotted dn- and marked with a zygotic components (such as sexual isolation) and post- small dab of fingernail polish according to their popula- zygotic components (such as hybrid inviability or tion ol origin. Then the 20 individuals were simulta- sterility). The former is Rpically assessed using mate neously introduced into a 2 liter glass beaker (filled choice tests (Bateson, 1983) and the latter by no-choice with 1,400 ml of filtered, aerated pond water) and breeding experiments (Covne and Orr, 2004). Here we placed on a glass table to facilitate obsemition. report the results of both mate choice and no-choice Mating actixitv was monitored lor 6 hours. When a breeding experiments between a reference population snail first successfully copulated as male (defined as the ol Plujsa Species A from South Carolina and P. acuta, complete insertion of its penis into the gonopore of a then (separately) Plu/sa Species A and P. pomilia. partner) itwas removedfrom thebeaker, its shell marked with a dot ol white correction fluid, and returned. Each indivitlual was often iiu'oK'ed in many matings over the MATERIALS AND METHODS 6 hours ofobseiwation, botfi iu the male and in the female role, but only its first successful copulation iu the male The Plu/sa acuta population used to found “line A” for role was recorded. This was an arbitran' decision on my these experiments inhabits tlie main pond at Chailes part (since both copulants in a pair might mate in either Towne Landing State Park, west of the Ashley River, role, and the result is not a "choice" but rather the out- wdthin the city limits of Charleston, SC (32.8062° N, come ol a contest), but necessaw nev'ertheless to prevent 79.9862° W). Snails ofthis population are not reprodnc- double-counting. Note that this design yields a slight bias tivelyisolated from P. acuta sampled near the pqoe local- toward heterogameticpairings, not 1:1 but rather9:10. ity for the species in Erance (Dillon et ak, 2002). The Each trial involved 20 fresh snails, entirely numated. Plu/sa pomilia population used here to found "line H” Three such trials were performed testing for sexual iso- was collected from the ty|3e locality for Plu/sa pomilia lation between Species A and acuta (tlie SA e.xperiment) hendersoni (Clench, 1925): the Combahee River at the and three additional trials performed testing foi' sexual US 21/17A bridge, 1 km E of Yemassee, Hampton isolation between Species A and/)omilia (the SH experi- County, SC (32.7060° N. 80.8281° W). Dillon et al. ment), pooling results wdthiu experiment to Held a maxi- (2007) reported no reproductive isolation behveen this mum of 60 obsenaitions in each case. Chi-square population and snails sampled from Conrad’s (1834) statistics were calculated from the pair of 2x2 coutin- tyjie locality for Plu/sa pomilia sensn stricto in Alabama. geucy tables that resulted, normalized by 4/N, as a mea- The reference population of Plu/sa Species A usetl to sure ol sexual isolation (Gilbert and Starmer, 1985). . , Page 278 THE NAUTILUS, Vol. 123, No. 4 Foi‘ no-choice tests of postzygotic reproductive isola- dle pair produced around week 5, and 1 late pair pro- tion, three sets ofincross control cups were established duced around week 10, to yield 9 FI pairs. So if the using pairs of unrelated parents drawni from the ten sib- pntativ'e hybrid progeny were reared from pairs SxAl, ships within each ofthe populations (S, H, and A), as for SxA2, and SxA3, for example, they were crossed as example SlxS2, S2xS3, SlOxSl. Two sets ofout- SAlxSA2 early, SA2xSA3 early, SASxSAl early, cross experimental cups were also established \Uth 10 SAlxSA2 middle, SA2xSA3 middle, . . . SA3xSAl late. pairs of snails across populations, the SA cross (SxAl, Nine crosseswerelikewiseconstitutedforcorresponding SxA2, . . . , SxAlO) and the SH cross (Sxlll, SxII2, . . controls S and A, and the total of3 x 9 = 27 crosses of SxIllO). Each pair ofparents received a water change FI snails reared to adulthood for each e.xperiment, with and fresh food eveiy 7 days, at which time the sides of weekly feeding and water change. An identical set of the cup were inspected for egg masses. (Note that any 27 cups was establishedto evaluate hybrid fertilityin the egg mass might result from outcrossing, or be the prod- SH experiment. I recorded the dates at which embiyos uct of sell-fertilization by either parent.) If egg masses and viable F2 hatchlings wereproducedbyeach pair. were present, all embiyos were counted and adults A larger sample of FI progeny from 3 outcross pairs transferred to a fresh cup. Eggs were monitored until from both the SA and SH experiments were reared to mm hatching (generally about 2 weeks) and all \4able, crawl- 4-5 shell length, at which time they were frozen in ing El juveniles counted. Obsemition was terminated 100 pi of tissue buffer for analysis by allozyme electro- upon the death ofeither parent in a pair. phoresis. We have identified 12 enzyme-encoding loci at Crosses were initiated wdth pairs of snails aged one which allozyme variation is inteqrretable as the product week post hatch. Then any difference in the central of codominant alleles segregating in Mendelian fashion temlency of age at first reproduction (in weeks post (Dillon and Wethington, 1994). These are aconitase hatch) between the 10 outcross pairs and the combina- (Aeon), esterases (three loci: Estl, Est3, Est6), glucose tion of both sets of 10 corresponding control pairs was phosphate isomerase (Gpi), isocitrate dehydrogenase tested by calculating a combined (30 pair) median and (tvv'o loci: Isdhl and Isdh2), leucine aminopeptidase comparing counts above and below that median using (Lap), mannose phosphate isomerase (Mpi), phospho- Fisher’s e.xact tests. glucomutase (twoloci: Pgml andPgni2), and6-phospho- For statistical analysis of fecundity and El viability, gluconate dehydrogenase (6pgd). We used horizontal week 1 was established separately for each set of 10 starch gel electrophoresis in an aminopropylmoqvholine pairs as the first week in which eggs were laid by 3 or pH 6 buffer system to resolve allozyme variation at the more pairs of parents. Embiyos and viable hatchlings Gpi, Isdh, and 6pgd loci, a Tris-Gitrate pH6 buffer sys- were snbsepnently counted for 10 weeks. I then aver- tem for Aeon, iVIpi, and Pgm, and a TEB8 system for aged the embiyo production of each pair of parents 6pgd, Lap, and Est. Details regarding our electropho- across its lifetime, ignoring any leading (pre-maturity) retic methods, includiug a description ofour equipment zeros and any postmortem zeros, while including as and recipes for stains and buffers, have been previously 0 any failure to reproduce by viable, mature pairs. So, published (Dillon, 1992; Dillon andWethington, 1995). for example, ifone parent in a pair ofsnails died atweek The set of no-choice mating experiments described 6, lea\4ng a record of 0, 0, 40, 0, 50 emlnyos forthe pair, above were conducted simultaneouslywith those ofDil- their mean fecunditv would be 90/3 = 30 embiyos per lon et al. (2007), using identical techniques. The data week. A Kruskal-Wallis nonparametric ANOkA^was used reported here on the reproductive performance of the to test whether any significant difference existed in the A and II incross control lines have been published pre- central tendency ofweekly mean fecimdiW ofeither set viously, although the SA and SH experimental results, as of 10 outcross pairs (SH or SA) and the 2 corresponding well as the S incross control, are original to the present sets of 10 control pairs. iiwestigation. Similarly, I averaged the counts ofFf hatchlings witli- in pairs across weeks, ignoring zeros not corresponding to embiyo production, and divided each pair mean byits RESULTS mean embiwo production to obtain pair mean Ff viabili- ty. If35 + 45 hatchlings were recovered from the exam- The SA mate choice experiments did not reveal any ple pairofsnails above, tlieir mean FI viabilitywould be evidence of sexual isolation betvv^een Species A and (35/40 + 45/50)/2 = 88.9%. Asecond Kruskal-Wallis non- P. acuta (Table 1, upper). A total of49 copulations were parametric ANOVAwas used to testwhether anysignifi- obseiwed (of a possible 60 total), apparently without cant difference existed in the central tendency ofweekly regard to species (normalized = 0.82, p = 0.37). The mean El viabilit)'postedbyeitliersetof 10outcrosspairs SH experiments did, how^ever, suggest prezygotic repro- and its 2 correspondingsets of 10 control pairs. ductive isolation between Species A and P. pomilia To assess the fertiliW ol putativ^e hybrid offspiing, FI (Table 1, lovv'er). The 38 copulations obseiwed in the SH hatchlings (from both experimental sets and all three mate choice tests includedonly2 olpomilia inseminated control sets) were reared Irom each of 3 separate unre- by a Species A partner, wiiile 10 pomilia were insemi- lated pairs to size 2 mm. These were crossed in time nated bypomilia partners. There was also a bias tow'ard series: 1 early pair from eggs laid around week 1, 1 mid- homozygotic pairings on the Species A side, yielding a R. T. Dillon, 2009 Page 279 Table 1. Copulations observed in the two mate choice lieterozygote at the Lsdh locus (Isdli""Visdh"*" x Lsdii’"*'/ experiments, Phi/sa Species A x P. acuta (above) and Phijsa fsdh'^'). ;ind one heterozygote at tlie E.st3 locus (Est3'*"V Species A x P. poinilia (lielow). Est3^"^“ X Est3'^^/Est3^^“), )4elding at both loci twelve FI progeny representing the heterozygous and one homozy- Males gousclass, missingtheotherhomozygousclassentirely.The Iloinogainetic Heterogametic Totals likelihood of missing a single homozygous class in Rvelve Females Species 15 15 30 selfedprogenyIrom aheterozygousparentwouldbe0.032. A(S) None of the nine pairs of Ff progeny from the SA P. acuta (A) 12 7 19 ontcross produced viable F2 offspring. One SA pair was terminated earlyby mortaliW, while the other eight pairs 49 all laid eggs profusely, beginning at week 7 and extend- Females Species 16 10 26 ing to week 19. All egg masses laid by all eight pairs of A(S) SA hybrids over the 12 week period were held for five PpomiliaiH) 10 2 12 weeks, wth no hatching observed. 38 Reared togetlierin a no-choice design, pairs of Species A and P. pomilia demonstrated significant delays in age at significant oveiall deviation from random mating (nor- first reproduction behind that postetl by their combined malized = 6-63, p = 0.01). wcoenetkrsolsat(tFhieshoenrssetexoafctegpg=lay0.i0n0g3w).asThseliigrhtmlyodbaelhiangdebooftl9i SpeRceiaersedAtaongdethP.eraciuntaansoh-ocwhoeidcenodesdieglna,yminixaegdepaatirfsirosft TthheeSpmeecdieisanA pcaornternotlalanfdeetnhnedirpio'miioila 2c7o.n3troelm(bTiaybolseA3v)k. reproduction, their modal age at maturation (7 wks) posted in the SII ontcross experiment was also signifi- indeed slightly less than that obseiwed in either matched AtShpeerceimdeuescdtiiAaonnoworafsm5a5a.tp2cpaheremedlnrtnac'inuotspaAavi'kceonpntotalsrotfleedcipmabdiyirts)S'A,(Thaoobnwtlecevreo2rs),s. gttcllaeiinneetelmSrypaeetdlciioioawennesrpvAritoahcbgaoienlnnittyrbvoolfto.rlhoOtminhneltciyhrreoospsSnreHocgooeneftnxrtypohele(rs6in4m(i.epn8ne%=t)py0ali.ioe0r0wsl2de)oer,fdtfa\hiinraasdn-t pTihtiers73s.ig1n%ifimceadntilayn bviealboilwitybootfhtheconFtfroSlpsec(ipes=A /0.a0c2u7t)a. ble second generation offspring, at week 20. Most ol tlie remaining first generation pairs laid eggs that failed to hybrids was intermediate between the FI viabilities hatch, generally over manyweeks ol obseiwation. obseiwed from incross controls. Electrophoretic analysis revealed that two sets of SH Electrophoretic analysis of a sample of offspring from parents were fortuitously fixed for altei'uative alleles at ptrhoregeenyS.AOonnetcrpoasisresofcpoanrfeinrtmsedwatshefohrytbnirtiodnistlyyoflixaeldl fFofr the LAP locus. Samples often first generation progeny from both ol these crosses yielded only one homozygous alternative alleles at the Isdh locus, yielding a sample of twelve entirely heterozygous progeny. A second pair of cAlaspsa,resnttr,onaglnydsnugogersetpirnogdusecltfi-ofenrtbilyiztahtieonpobmyiltihae Sppaerceinet.s SA parents were both heterozygous at the Est3 locus Absence of suitable genetic markers made inference re- (Est3^*“’/Est3'’^'’ X Est3'"^^/Est3'^“),yieldingtwelve FI proge- garding the third set ofSII progeny analyzed eqnixocal. ny in four classes. The thiixl pair ol parents included oue Table 2. Statistics comparing the fitness of Plu/sa Species Table 3. Statistics comparing tlie fitness of Plu/sa Species A X P. acuta ontcrosses to pure Plu/sa Species A and pure A X P. juunilia ontcrosses to pure Plu/sa Species A ami pure P. acuta controls. P. pomilia controls. Species A SA ontcross P. acuta Species A SH ontcross P. pouiiha First oviposition, P generation Firstoviposition, Pgeneration Mode (weeks post hatch) 8 7 8 Mode (weeks post hatch) 8 9 7 Range 7-8 7-10 5-10 Range 7-8 8-12 7-11 Weekly mean parental Weekly mean parental fecundity fecundity Median (embiyos) 75.4 55.2 66.9 Median (emhiyos) 75,4 27.3 57.4 Range 19-]05 18-81 17-104 Range 19-105 7-41 19-68 Weekly mean FI vnahility Weekly mean FI viahility Median (%) 80.5 73.1 61.7 Median (%) 80.5 64.8 55.8 Range 66-91 49-99 45-86 Range 66-91 10-86 33-86 FI Fertility 67% 0% 100% FI Fertility 67% 10% 78% \7ahle F2 liatch Viable F2 hatch Median (week) 12.5 - 9 Median (week) 12.5 20 5 Range 4-19 - 9-11 Range 4-19 - 3-8 Pare 2S0 THE NAUTILUS, Vol. 123, No. 4 DISCUSSION described for the interspecific pairing of Pluj.sa acuta and P. pomilia (Dillon et ak, 2007). The experiments reported here confirm reproductive Although nothing is known about the genetics of re- isolation between the "Fhi/sa Species A" ofWethington productive isolation in pulmonate snails, a large body of (2004) and populations representing both of the other research has confirmed that froth prezygotic and postzy- physid species inhabiting South Carolina, P. acuta and gotic barriers are inherited in a complex and polygenic P. poiniUa. An initiative to formally describe Species A fashion in Drosophila (Wu and Palopoli, 1993; Bitchie has jnst been published (Wethington et ah, 2009). The and Phillips, 1998). In general it has been found that reproductive isolation displayed bythese three species is postzygotic isolating mechanisms evolve independently of different degrees, however, and apparently more of, and tend to lag behind, prezygotic mechanisms closely related to their genetic divergence than to their (Coyne and Orr, 2004). Whether the latter can be rein- reproductive anatomy. mtPDhiNjsAa pShpyelcioegsronApa(nWdetPh.inagctutoan calnudsteLrydienartdh,e 2s0a0m7e) sfioalr.ceEd.xlpiyerniamtemn-tasl tsoeltercatcieonthoenetvhoeluftoiromneorfibsoctohntsreotvsero-f characters through the larger phylogeny ofthe Physidae but differ in their penial anatomy. The mate choice tests are currently ongoing. reported here yielded no evidence of sexual isolation between them. A significant retluction in the joint fecun- dit\' of Species A x P. acuta outcross pairs was indeed ACKNOWLEDGMENTS revealed by no-choice breeding experiments, although there was no evidence of reduced \4ability in the FI 1 thank Tom Smith, Charles Earnhardt, and Tommy hybrids such crosses produced. Species A x acuta McCullough for help \\4th laboratoiy work of all sorts - hybrids were, however, entirely sterile. snail culturing, mate choice, and electrophoretic analy- Plu/sa Species A aiulP. pomilia share identical tx^re-bc sis. Amy Wethington and John Wise provided helpful penial anatomy, hut are more distantly related genetical- coniments on the manuscript. This research was ly. The reproductive isolation that Species A andpomilia supportetl by a grant from the National Science Foundation, DEB-0128964. displayundercontrolledconditions is ofagreaterdegree than that ohseix/etl between Species A and acuta. Paired in a no-choice design. Species A and pomilia parents LITEBATURE CITED displayeddelayed reproduction, reducedfertility, andre- duced offspring viability. All the viable first-generation Bateman, A. 1949, Analysis ofdata on sexual isolation. Evolu- progenyrecovered from SIl outcrosseswere attributable tion 3: 174-177. toself-fertilization bythe Species Aparent, reproduction Bateson, P. 1983. Mate Choice. Cambridge University Press, by the pomilia parent apparently foreclosed. It seems Cambridge, U.K. 480 pp. likely that the substantial reduction in reproductive suc- Bousset, L., P.-Y. Heniy, P. Sourrouille, and P. fame. 2004. cess demonstrated in the second generation by SH off- aPcouptualataipopnrobiaoclhoeg)d' otfhrtohuegihnvgaesniveetifcremsahrwkaetresr,sneaciolloPgliujcsaal spring may be attributable to Species A inbreeding cliaracteiization and demography. Molecular Ecology 13: depression. Such results are (piite simiar to those we 2023-2036. obtained from crosses between the t\pe-c Pht/sa acuta Coviie, }., and PI. Orr. 2004. Speciation. Sinauer Associates, and the t\pe-b Phi/sa gi/ri)w (Dillon et ah, 2004). Sunderland, MA. 54.5 pp. In addition, mate choice tests returned evidence of DeWitt, T. 1991. Mating behavior ofthe freshwater pulmo- f. prezygotic reproductive isolation between Species A nate snail, Plu/sa gijrina. American Malacological Bulletin and P. pomilia. Physids seem to mate according to a 9: 81-84. modified “Bateman's Principle" (Bateman, 1949). They DeWitt, T. 1996. Gender contests in asimultaneous hermaph- are generally (juick to copulate as males, and display rodite snail: a size-advantage model of beha\lor. Animal Behaviour51: .34.5-351, lriotlteletdhiesycrciamninaltieiocnh,oohsuyt, wohfteenn mdiosupnltayeidnginretjehcetifveemablee- DilloWn,orlR.dT.A,qiifra,cu1l9t9u2r.e 2E3l(e2c):tr4o8p-h5o1r.esis IV, nuts and bolts. h1a9v9i6o;rsWeltihkeinegvtaosnion& aDnidllosnh,el1l9-9s6h;akiMncgCa(rDteWhiytta,nd19S9i1h;, Dillonti,veB.iTs.o,la|tr.i,onC.beEatrwneheanrdPtl,ujasnadaTc.utSamiathn.d2P0l0u4j.saRgetp/rroiudauci-n 2008). Only 38 of the 60 snails tested in the SH mate joint culture. American Malacological Bulletin 19: 6.3-68. choice experiments were ultimately able to mate as Dillon. R.T., Jr., J. Robinson, T. Smith, and A. R.Wethington. males, at least partly because of tlie high frequency of 2005. No reproductive isolation between the freshwater rejective behaviors they encountered in heterogametic pulmonate snails Plu/sa acuta and Plu/sa virgata. So\ith- couplings. Our obsemition tliat pomilia copulants were western Naturalist 5(): 41.5-422. more rejective of heterogametic insemination than Spe- Dillou, R.T., (r., J. Robinson, and A.R. Wethington. 2007. cies A copulants may he related to our separate obsemi- Empirical estimates of reproductive isolation among the tion that the Species A partner in onr SH no-choice Pf.rehcsihtwcaltcersrnupiu.lMmaolnaactoelosgniaail4s9:Pl2u8j,s3a-2a9c2u.ta. P. pomilia. and experiments retained the abilit)' to reproduce by self- Dillon, R.T., Jr., and A.R. Wethington. 1992. The inheritance fertilization, while tlie poutilia partner apparently did of albinism in a freshwater snail, Plu/sa heterosfropha. not. This situation is similar to that we have previously Journal ol Heredity 83: 208-210. . R. T. Dillon, 2009 Fdge 281 Dillon, R.T., |r., and A.R. Wethington. 1994. Inheritance at (cfls.), Entlless forms: species anti speciation. Oxlortl Uni- five loci in the freshwater snail, Pin/.sa heterostro])ha. versit)'- Press, Oxfortl, U.K. 496 pp. Biochemical Genetics 32: 75-S2. Te, G.A. 1978. The Systematics t)f tlie Family Pbysitlae Dillon, R.T., Jr., and A.R. Wethington. 1995. The hiogeogra- (Bast)mmatophora:Puhnt)nata), Ph. D. Dissertation, Uni- phy of sea islands: Clues from the population genetics versity''of Michigan, Ann Arbt)r. 325 pp. of the freshwater snail, Pln/.sa hctcrostropha Systematic Te, G.A. 1980. New classification system for the family Plysi- Biology44: 4()()-40S. dae. Archiv fuer Molluskenknntle 110: 179-184. f)illon, R.T., Jr., and A.R. Wetliington. 2006a. No-choice mat- Tsitnnie, A., P. Jarne anti P. Da\'id. 2003. Delayetl selling and ing e.xperiments among six nominal taxa of the snhgenns resource allocations in relation tt) mate availabilitv in the Phi/.sella (Basommatophora: Physidae). Ifeldia 6: 69-78. freshwater snail Plu/.sa acuta. Americtm Naturalist 162: Dillon, R.T., Jr., anti A.R. Wetliington. 2006b. The Michigan 474-488. Physidae revisited: A population genetic smwey. Malaco- Wethingttni, A.R. 2004. Phylogeny, Taxonomy', and Ex’olution logia48: 133-142. t)l Reprt)ducti\’e Isttlation in Plu/.sa (Pulmonata: f^hysi- Dillon, R.T, Jr., A.R. Wethington, ]. Rhett, anti T. Smith. tlae). Pli.D. Dissertatitm, University' of Alabama, Tusca- 2002. Populations of the European freshwater pnimonate loosa. 119 pp. Plii/sa acuta are not reprotlnctively isolatetl from Ameri- Wethington, A.R. and R.T. Dillon, Jr. 1991. Sperm storageanti can Phijsa lietcro.stroj)lia or Phijaa Integra. Invertebrate evitlence for multipleinseminatittn in anatural ptipulation Bioltigy 121; 226-234. t)f the freshwater snail, Plu/.sa. American Malact)lt)gical Escobar,J., G. Epinat,V Sartla, and P. David. 2007. Nocorrela- Bulletin 9: 99-102. tion between inbreetling tlepression anti tlelayed sellingin Wethington, A.R. tint! R.T. Dillon, Jr. 1993. Reprotluctive de- thefreshwatersnailPlu/saacuta. Evolntitin 61: 2655-2670. veltipment in the hermaphrotlitic freshwater smiil, Plu/.sa, Gilbert, D. and W. Starmer. 1985. Statistics ofsexual isolation. monitored with complementing albino lines. Proceetlings Evolution 39: 1380-1383. t)f the Roy'al St)cietv't)f Londtni B 252: 109-114. llemy, P.-Y., L. Btinsset, P. Sonrrouille, and P. Jarne. 2005. Par- Wethington, A.R. and R. T. Dilltni, Jr. 1996, Gentler chttice tial selling, ecological disturbance and reproductive assur- and gentler conflict in a non-reciprocally mating simulta- ancein aninvasivefreshwatersnail. Hereditv95: 428-436. net)us hermaphrodite, the freshwatei' snail, Plu/.sa. Animal Menrv', P.-Y., L. X'imond, T. Lenormantl, and P Jarne. 2006. Behaviour51: 1107-1118. Is tlelayed selling adjustetl to chemical cues ofdensit)- in Wetliington, A.R. and R.T, Dilltin, Jr. 1997. Selling, outcross- the freshwater snail Phifsa acuta? Oikos 112: 448-455. ing, and mixed mating in the freshwater snail Plu/.sa het- Mayr, E. 1942. Systematics and the firigin ofSpecies. Ct)lum- ew.stroplia-. lifetime fitness and inbreetling tlepression. bia University Press, NewYork. 811 pp. Invertebrate Biology' 116: 192-199. Mayr, E. 1963. Animal Species and Evt)liition. Belknap, Cam- Wethington, A.R. and G. Lydeartl. 2007. A molecularpbyloge- bridge, MA. 797 pp, ny of Physitlae (Gastroptida: Basommatophora) based on McCarthy, T. anti A. Sih. 2008. Relatedness t)f mates influ- mitochontlrial DNA setjuences. Journal of Mtilluscan ences mating behavit)ur and reproductive success t)l the Stutlies 73: 241-257. hermaphroditic freshwater snail Pliifsa gi/riua. Evttlntion- Wethington, A.R., J. Wise and R.T. Dilltin, Jr. 2009. Gene- aiy Ecology Research 10: 77-94. tic and moipliological characterizatitin tif the Phy'sitlae tif PiU'aense, W, andJ.-P. Pointier, 2003. Plu/.saacuta Draparnaud, South Carolina (Pulmonata: Basommatophora), xCth de- 1805 (Ga,strt)pocla: Phy.sitlae): a study t)f topoty^ric spec- scription of a newspecies. The Nautilus 123; 282—292. imens. Memoriasdo InstitutoOsw;iltloCruz98: 513-517. Wu, G-1., and M.F Palopoli. 1993. Genetics of postmating Ritchie, M.G., anti S.D.F. Phillips. 1998. Thegenetics t)f.sexual reproductis'e isolatitin in animals. Annual Review tif isolation. Pp. 291-308in D.A. Ilttwardanti S.H. Berlocher Genetics 27: 283-308.

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.