ebook img

Counting with Symmetric Functions PDF

132 Pages·2014·0.707 MB·English
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Counting with Symmetric Functions

Counting with Symmetric Functions Anthony Mendes ([email protected]) Math 435/530, Fall 2014, Cal Poly San Luis Obispo Contents 1 Permutations,Partitions,andPowerSeries ....................... 1 1.1 Permutationsandrearrangements ............................. 1 1.2 Integerpartitionsandtableaux................................ 7 1.3 Generatingfunctions........................................ 11 Exercises ...................................................... 17 Notes ......................................................... 20 2 Symmetricfunctions............................................ 21 2.1 Fivebasesforsymmetricfunctions............................ 21 2.2 Relationshipsbetweenbasesforsymmetricfunctions ............ 29 2.3 TransitionMatrices ......................................... 34 Exercises ...................................................... 42 Notes ......................................................... 46 3 Countingwiththeelementaryandhomogeneous................... 47 3.1 Countingdescents .......................................... 47 3.2 Changingbricklabels ....................................... 57 Exercises ...................................................... 65 Notes ......................................................... 70 4 Countingwithanonstandardbasis............................... 71 4.1 Thebasis p ............................................. 71 ν,n 4.2 Countingwiththeelementaryand p ......................... 73 ν,n 4.3 Recurrences ............................................... 80 4.4 Theexponentialformula..................................... 82 4.5 Consecutivepatterns........................................ 91 Exercises ......................................................101 Notes .........................................................103 1 2 Contents 5 CountingwithRSK ............................................105 5.1 TheRSKalgorithm.........................................105 5.2 Weaklyincreasingsubsequencesinwords ......................110 Exercises ......................................................114 Notes .........................................................114 6 Countingproblemsthatinvolvesymmetry ........................115 6.1 Po´lya’senumerationtheorem.................................115 Exercises ......................................................118 Notes .........................................................119 TransitionMatrices.................................................121 References.........................................................123 Index .............................................................127 Chapter 1 Permutations, Partitions, and Power Series Permutations, integer partitions, and power series are three fundamental topics which are central to combinatorics. This chapter introduces these ideas, providing themathematicalinfrastructureforourfuturework. 1.1 Permutationsandrearrangements A permutation of n is a rearrangement of the integers 1,...,n. Permutations have a wide variety of applications in numerous subjects; they are essential in algebra, computerscience,andstatistics. Let S be the set of all permutations of n, a set called the symmetric group. A n permutation statistic is a function mapping S into the nonnegative integers. Four n importantexamplesofpermutationstatisticsarethedescent,excedance,inversion, andmajorindexstatistics,denotedbydes,exc,invandmaj.Foranyfinitesequence σ =σ ···σ ofintegers,wedefinethesestatisticsby 1 n des(σ)=(thenumberofindicesiwithσ >σ ), i i+1 exc(σ)=(thenumberofindicesiwithσ >i), i inv(σ)=(thenumberofindicesiand jwithi< jandσ >σ ), i j maj(σ)=(thesumoftheindicesiwithσ >σ ). i i+1 ThesestatisticsonS aredisplayedbelow: 3 σ des(σ) exc(σ) inv(σ) maj(σ) 123 0 0 0 0 132 1 1 1 2 213 1 1 1 1 231 1 2 2 2 312 1 1 2 1 321 2 1 3 3 1 2 1 Permutations,Partitions,andPowerSeries Itisnoaccidentthatthefirsttwoandthelasttwocolumnsofthetableareequidis- tributed,thatis,theyhavethesamenumberof0’s,1’s,2’s,and3’s. Understanding the properties of these statistics, subsequent generalizations of thesestatistics,andmanynewpermutationstatistics,isstillanactiveareaofmathe- maticalresearch.Inonlythepastfewdecades,beautifulcombinatorialandbijective proofsofclassicalandnewresultshavebeenpublished.Oneofthefirstalongthese linesprovesthattheinversionandmajorindexstatisticsareequidistributedoverthe symmetricgroup,aresultofourTheorems1.2and1.3. A permutation σ =σ ···σ ∈S is the bijection from {1,...,n} to {1,...,n} 1 n n whichsendsitoσ.Ifσ−1=σ−1···σ−1istheinversetoσ,theni< jandσ >σ i 1 n i j ifandonlyifσ−1<σ−1and j>i.Thismeansinv(σ)=inv(σ−1)forallσ ∈S . j i n Permutationscanbewrittenincyclicnotationbyletting (a a a ··· a )(b b ··· b )··· 1 2 3 k 1 2 j represent the permutation which has a in position a , a in position a , a in po- 1 k 2 1 3 sition a , and so on. For example, (1 3 2 4)(5)(6 7 8) represents the permutation 1 43215786. Theorem1.1.DescentsandexcedancesareequidistributedoverS . n Proof. Wewilldefineabijectionϕ :S →S suchthatifσ =σ ···σ ∈S hask n n 1 n n descents,thenexc(ϕ(σ))willalsoequalk. Suppose σ = 1. Erase the first j integers in σ and begin to construct ϕ(σ) j with the cycle (σ ···σ σ ). Continue this process iteratively with the next small- j 2 1 est integer in what remains in σ, building up ϕ(σ) cycle by cycle. For example, if σ =9 3 1 6 8 2 7 4 5, then ϕ(σ) is the permutation (1 3 9)(2 8 6)(4 7)(5) in cyclic notation. This construction does not break σ at a descent and writes cy- cles in ϕ(σ) in such a way that if σ >σ if and only if i<ϕ(σ). Therefore i i+1 i des(σ)=exc(ϕ(σ)). (cid:116)(cid:117) Theq-analogueof0is[0] =0andtheq-analogueofthepositiveintegernis q 1−qn [n] =1+q+···+qn−1= . q 1−q whereqisanindeterminate.Theq-analogueofnisageneralizationofn.Afterall, bytakingq=1(or,ifwewrite[n] =(1−qn)/(1−q),bytakingthelimitasq→1), q werecovern.However,weshouldrefrainfromthinkingaboutqasavariable.The indeterminateqissimplyadevicetotracktheoperationsperformedonn.Thisqis ourbookkeeper. Theq-analoguesofn!andthebinomialcoefficient(cid:0)n(cid:1)canbedefinedinstraight- k forwardsways;wedefine[0] !=1andforintegersk≤nwedefine q (cid:20) (cid:21) n [n] ! q [n] !=[n] [n−1] ···[1] and = . q q q q k [k] ![n−k] ! q q q 1.1 Permutationsandrearrangements 3 Theorem1.2.Ifnisapositiveinteger,then[n] != ∑ qinv(σ). q σ∈Sn Proof. Thestatementistrueforn=1.Weproceedbyinductiononn. There are n places to insert the integer n into a permutation σ =σ ···σ ∈ 1 n−1 S inordertocreateanelementofS .Wecaninsertninthepositionimmediately n−1 n precedingσ foreach1≤i≤n−1orwecaninsertnafterσ .Ifweinsertninthe i n−1 positionimmediatelybeforeσ,thenwehaveintroducedn−inewinversionsinto i thepermutation.Ifweplacethenattheendofσ,weintroducenonewinversions. Theexponentsonqin1+q1+···+qn−1correspondtotheinversionscausedbyn. Wenowhavethat ∑ qinv(σ)=(cid:0)1+q+···+qn−1(cid:1) ∑ qinv(σ)=[n] [n−1] !. q q σ∈Sn σ∈Sn−1 Since[n] !=[n] [n−1] !,thiscompletestheproof. (cid:116)(cid:117) q q q Theorem1.3.Ifnisapositiveinteger,then[n] != ∑ qmaj(σ). q σ∈Sn Proof. Thestatementistrueforn=1.Weproceedbyinductiononn. Therearenplacestoinserttheintegernintoapermutationofσ ∈S inorder n−1 to create an element of S . Label these places with the integers 0,...,n−1 in the n followingway: 1. Labelthelastplacewith0. 2. Labeltheplacesfallingbetweendescentsfromrighttoleftwith1,...,des(σ). 3. Labeltheremainingplacesfromlefttorightwithdes(σ)+1,...,n−1. Forexample,ifσ =18753624,thenourlabelingis: 1 8 7 5 3 6 2 4 5 6 4 3 2 7 1 8 0 Theselabelsgivethenetincreasetothemajorindexwhennisinsertedintoσ. Certainly inserting the n in the last position does not change the major index. If n isplacedbetweenadescent,thenthetotalnumberofdescentsdoesnotchange,but the index of that descent and every descent to the right is increased by 1. Lastly, insertingnanywhereelsenotonlycreatesadescent,butalsoincreasestheindexof allotherdescentstotheright. Theexponentsonqin1+q1+···+qn−1correspondtotheincreasetothemajor indexcausedbyn.Wenowhavethat ∑ qmaj(σ)=(cid:0)1+q+···+qn−1(cid:1) ∑ qmaj(σ)=[n] [n−1] !. q q σ∈Sn σ∈Sn−1 Since[n] !=[n] [n−1] !,thiscompletestheproof. (cid:116)(cid:117) q q q 4 1 Permutations,Partitions,andPowerSeries Theorems1.2and1.3togetherimplythattheinversionandmajorindexpermuta- tionstatisticsareequidistributed.Theproofsofthesetwotheoremscanbemodified toarriveatabijectiveproof;thatis,wecancreateabijectionϕ :S →S suchthat n n inv(σ)=maj(ϕ(σ))forallσ ∈S . n Createthepermutationσ,startingwiththepermutation1∈S ,byinsertingthe 1 integers2,...,nintothepreviouspermutationandkeepingtrackofinversionsalong theway.Forexample,ifσ =81276435,wehave σ inversions 1 0 12 0 123 0 1243 1 11435 1 126435 4 1276435 8 81276435 15 To find the permutation ϕ(σ), build a permutation in S by using the labeling n schemeintheproofofTheorem1.3whileforcingthemajorindexstatistictobethe sameastheinversionstatisticateachstep.Intheexampleofσ =81276435, thismeans σ majorindex 1 0 12 0 123 0 4123 1 41235 1 416235 4 4176235 8 41762385 15 Thisshowsthatϕ(81276435)=41762385. Let R(0k,1n−k) denote the set of all possible rearrangements of k 0(cid:48)s and n−k 1’s. These definitions of descent, excedance, inversions, and major index are still validforelementsofR(0k,1n−k)aswellaspermutationsofn. (cid:20) (cid:21) n Theorem1.4.If0≤k≤n,then = ∑ qinv(r). k q r∈R(0k,1n−k) Proof. Rewritten,thestatementinthisTheoremis   [n]q!=[k]q![n−k]q! ∑ qinv(r). r∈R(0k,1n−k) UsingTheorem1.2,thisisequivalenttoshowing 1.1 Permutationsandrearrangements 5 (cid:32) (cid:33) (cid:32) (cid:33)(cid:32) (cid:33)  ∑ qinv(σ) = ∑ qinv(α) ∑ qinv(β)  ∑ qinv(r). σ∈Sn α∈Sk β∈Sn−k r∈R(0k,1n−k) Thiswillbedonebijectivelybydisplayingabijectionϕ:S ×S ×R(0k,1n−k)→ k n−k S suchthat n inv(α)+inv(β)+inv(r)=inv(ϕ((α,β,r))) forall(α,β,r)∈S ×S ×R(0n−k,1k). k n−k Given (α,β,r)∈S ×S ×R(0n−k,1k), write down r. Write down α under- k n−k neaththe0’sinr.Addkeachintegerinβ andwritedowntheresultunderneaththe 1’sinr.Defineϕ((α,β,r))tobethepermutationσ nowwrittenunderneathr.For example,whenα =3124,β =641352,andr=1001110101,wehave 1 001110101 10318572946 Thisprocessisreversible,andthereforeabijection.Thetotalnumberofinversions isthecorrectnumbersincetheintegersinα andtheintegersinβ keeptheirrelative orderandthereareadditionalinversionsintheresultingpermutationeverytimea1 appearsbeforea0inr. (cid:116)(cid:117) Theorem1.4implies(cid:2)n(cid:3) mustbeapolynomialinqforalln≥k,afactwhich k q doesnotimmediatelyfollowfromthedefinitionoftheq-binomialcoefficient. Theorem1.5.If0≤k≤n,then (cid:20) (cid:21) n = ∑ qmaj(r). k q r∈R(0k,1n−k) Proof. Theorem 1.4 allows us to prove this result by exhibiting a bijection ϕ : R(0k,1n−k)→R(0k,1n−k)suchthatmaj(r)=inv(ϕ(r))forallr∈R(0k,1n−k). WefirstdefineabijectionΓ :R(0k,1n−k)→R(0k,1n−k).Ifrendswitha0,define Γ(r)toberwitheveryconsecutivesubstringoftheform1···10changedto01···1. Ifr endswitha1,defineΓ(r)tober witheveryconsecutivesubstringotheform 0···01changedto10···0.Forexample,Γ(1100010100)=0110001010. If r ends with a 0, then inv(Γ(r))=inv(r)−(n−k) because changing 01···1 into01···1forall1’sinrdecreasesthenumberofinversionsinrby1foreachof then−k1’sinr.Similarly,ifrendswitha1,theninv(Γ(r))=inv(r)+k. If the length of r is either 0 or 1, then we define ϕ(r)=r. Otherwise, let w be therearrangementforwhichr=w01···1;thatis,wisrwiththelast0andtrailing 1’s deleted. For any rearrangement r∈R(0k,1n−k) we define ϕ(r) recursively by ϕ(r)=Γ(ϕ(w))01···1.Itcanbecheckedthatϕ(10110100011)=00111010011. Bydefinition,ϕ(r)endswitha0ifandonlyifrendswitha0. Thefactthatϕ isabijectionfollowsfromthefactthatΓ isabijection.Tocom- pletetheproof,wewillshowthatmaj(r)=inv(ϕ(r))byinductiononthelengthof r.Supposeweadda0totheendofr∈R(0k,1n−k).Thenwehave 6 1 Permutations,Partitions,andPowerSeries inv(ϕ(r0))=inv(Γ(ϕ(r))0) =inv(Γ(ϕ(r)))+(n−k) (cid:40) inv(ϕ(r))−(n−k)+(n−k) ifϕ(r)endsin0 = inv(ϕ(r))+k+(n−k) ifϕ(r)endsin1. Using the induction hypothesis and the fact that ϕ(r) ends in a 0 if and only if r does,thisisequalto (cid:40) maj(r) ifrendsin0 maj(r)+n ifrendsin1. Inbothcases,thisisequaltomaj(r0).Wehaveshownthatinv(ϕ(r0))=maj(r0). Now suppose we add a 1 onto the end of r. Since ϕ(r1)=Γ(ϕ(w))01···11= ϕ(r)1,wehave inv(ϕ(r1))=inv(ϕ(r)1)=inv(ϕ(r))=maj(r)=maj(r1). Thiscompletestheproof. (cid:116)(cid:117) Theorem1.6.Let n and k be positive integers with k ≤ n and let q be a prime number.Then(cid:2)n(cid:3) isequaltothenumberofk-dimensionalvectorsubspacesofthe k q vectorspaceofdimensionnoverthefinitefieldwithqelements. Proof. Wefirstfindthenumberofwaysofselectingklinearlyindependentvectors. Thereareqn−1choicesforthefirstvectorsincewecanfreelyselectanyoftheqn vectorsinthevectorspaceexceptforthezerovector.Thereareqn−qchoicesfor thesecondvectorsincewecanselectanyoftheqn−qvectorswhicharenotlinear combinationsofourfirstchoiceofvector.Continuingthisidea,thereare (qn−1)(qn−q)···(qn−qk−1) possiblesetsofklinearlyindependentvectors. This same counting argument implies that are (qk−1)(qk−q)···(qk−qk−1) possible bases for a k-dimensional subspace. Every set of k linearly independent vectorscanserveasabasisforak-dimensionalsubspace,sothetotalnumberofk dimensionalsubspacesofis (qn−1)(qn−q)···(qn−qk−1) (qn−1)(qn−1−1)···(qn−k+1−1) = (qk−1)(qk−q)···(qk−qk−1) (qk−1)(qk−1−1)···(q−1) [n] [n−1] ···[n−k+1] q q q = [k] [k−1] ···[1] q q q (cid:20) (cid:21) n = , k q asdesired. (cid:116)(cid:117) 1.2 Integerpartitionsandtableaux 7 1.2 Integerpartitionsandtableaux An integer partition of n, written λ (cid:96)n, is a finite sequence of weakly decreasing nonnegative integers. If λ =(λ ,...,λ )(cid:96)n with λ (cid:54)=0, then we write |λ|=n, 1 k k (cid:96)(λ)=k,andmax(λ)=λ .Belowareall7integerpartitionsof5: 1 (5), (4,1), (3,2), (3,1,1), (2,2,1), (2,1,1,1), (1,1,1,1,1). In this order, the lengths (cid:96)(λ) are 1,2,2,3,3,4,5 while the maximum parts are 5,4,3,3,2,2,1. Occasionally it may be convenient to denote λ as 1m12m23m3··· ifλ hasm partsofsizei.Usingthisnotation,theintegerpartitionsof5are i 51, 1141, 2131, 1231, 1122, 1321, 15. Integer partitions can be identified by their Young diagram; this is a collection ofleftjustifiedrowsofboxeswhererowihasλ boxesreadingfrombottomtotop. i TheYoungdiagramsfortheintegerpartitionsof5are . InmanyplacesYoungdiagramsaredrawnwiththelargestrowontop;inthisway theintegerpartition(5,3,2)wouldbedrawnas . ThemathematicsisindifferenttothemannerinwhichYoungdiagramsaredrawn, and so the choice whether to draw them with maximum part on the bottom or on thetopisamatterofpersonalpreference.WepreferdrawingYoungdiagramswith largest row on the bottom since it then appears as if the cells of the diagrams are affectedbygravity. Integer partitions can be ordered by the reverse lexicographic order. We define integer partitions λ,µ (cid:96)n to satisfy the relation λ ≤µ if the largest part of λ is greater than the largest part of µ. If the largest parts in λ and µ are the same, then inductively consider the second largest parts of these partitions. The integer partitions of 5 listed above are already written in increasing reverse lexicographic order. Theorem1.7.Thenumberofintegerpartitionsλ (cid:96)nwith(cid:96)(λ)=kisequaltothe numberofintegerpartitionsλ (cid:96)nwithmax(λ)=k. Proof. Takeλ (cid:96)nwith(cid:96)(λ)=k.InterchangerowsandcolumnsintheYoungdia- gramofλ tocreatetheintegerpartitionλ(cid:48).Forinstance,

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.