ebook img

Control of Gene Expression by Catecholamines and the Renin-Angiotensin System PDF

226 Pages·2000·9.497 MB·English
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Control of Gene Expression by Catecholamines and the Renin-Angiotensin System

CONTROL OF GENE EXPRESSION BY CATECHOLAMINES AND THE RENIN-ANGIOTENSIN SYSTEM Control of Gene Expression by Cat- echolamines and the Renin-Angiotensin System Edited by HEINZ RUPP BERNARD MAISCH Internal Medicine and Cardiology Internal Medical Molecular Cardiology Laboratory Molecular Cardiology Laboratory Philipps University of Marburg Philipps University of Marburg Karl-von-Frisch-Strasse 1 Karl-von-Frisch-Strasse 35044 Marburg, Germany 35033 Marburg, Germany Reprinted from Molecular and Cel/ular Biochemistry, Volume 212 (2000) Springer Science+Business Media, LLC Library of Congress Cataloging-in-Publication Data Control of gene expression by catecholamines and the renin-angiotensin system / edited by Heinz Rupp, Bemhard Maisch p. cm. -- (Developments in molecular and cellular biochemistry ; v. 33) ISBN 978-1-4613-6955-4 ISBN 978-1-4615-4351-0 (eBook) DOI 10.1007/978-1-4615-4351-0 1. Genetic regulation. 2. Angiotensin II. 3. Catecholamines. 1. Rupp, Heinz. II. Maisch, Bemard. III. Series QH450 .C66 2000 572.8'65--dc21 00-135010 Printed an acid-free paper All rights reserved © 2000 Springer Science+Business Media New York OriginallY published by Kluwer Academic Publishers in 2000 No part of the material protected by this copyright notice may be reproduced or utilized in any form or by any means, electronic ar mechanical, including photocopying, recording or by any information storage and retrieval system, without written permission from the copyright owner Molecular and Cellular Biochemistry: An International Journal for Chemical Biology in Health and Disease CONTENTS VOLUME 212, Nos. 1 & 2, September 2000 Control of gene expression by catecholamines and the renin-angiotensin system Drs. Heinz Rupp and Bernard Maisch Preface P. Haus-Seuffert and M. Meisterernst: Mechanisms of transcriptional activation of cAMP-responsive element-binding protein CREB 5-9 F.U. Muller, I Neumann and W. Schmitz: Transcriptional regulation by cAMP in the heart 11-17 D. Jean and M. Bar-Eli: Regulation of tumor growth and metastasis of human melanoma by the CREB transcription factor family 19--28 YS. Cho-Chung, YG. Park, M. Nesterova, YN. Lee and YS. Cho: CRE-decoy oligonucleotide-inhibition of gene expression and tumor growth 29--34 A. von Knethen and B. Brune: Attenuation of macrophage apoptosis by the cAMP-signaling system 35-43 U. Riese, S. Brenner, W.-D. Docke, S. Prosch, P. Reinke, M. Oppert, H.-D. Yolk and C. Platzer: Catecholamines induce IL-I0 release in patients suffering from acute myocardial infarction by transactivating its promoter in monocytic but not in T-cells 45-50 I Lim, C. Yang, SJ. Hong and K.-S. Kim: Regulation oftyrosine hydroxylase gene transcription by the cAMP-signaling pathway: Involvement of multiple transcription factors 51-60 M. Sieber-Blum and Z. Ren: Norepinephrine transporter expression and function in noradrenergic cell differentiation 61-70 IS.D. Chan, T.-T. Wang, S.-L. Zhang, X. Chen and S. Carriere: Catecholamines and angiotensinogen gene expression in kidney proximal tubular cells 73-79 C.S. Narayanan, Y Cui, S. Kumar and A. Kumar: cAMP increases the expression of human angiotensinogen gene through a combination of cyclic AMP responsive element binding protein and a liver specific transcription factor 81-90 P.P. Sayeski, M.S. Ali and K.E. Bernstein: The role ofCa2+ mobilization and heterotrimeric G protein activation in mediating tyrosine phosphorylation signaling patterns in vascular smooth muscle cells 91-98 S. Meloche, S. Pelletier and M.J. Servant: Functional cross-talk between the cyclic AMP and Jak/STAT signaling pathways in vascular smooth muscle cells 99--109 X. Wang and T.I Murphy: The inducible cAMP early repressor ICERIIy inhibits CREB andAP-I transcription but not AT I receptor gene expression in vascular smooth muscle cells 111-119 SJ. Vyas, C.M. Baschak, M.R. Chinoy and E.K. Jackson: Angiotensin II-induced changes in G-protein expression and resistance of renal microvessels in young genetically hypertensive rats 121-129 A. Dagnino-Subiabre, K. Marcelain, C. Arriagada, I. Paris, P. Caviedes, R. Caviedes and I Segura-Aguilar: Angiotensin receptor II is present in dopaminergic cell line of rat substantia nigra and it is down regulated by aminochrome 131-134 H. Rupp, M. Benkel and B. Maisch: Control of cardiomyocyte gene expression as drug target 135-142 D. Mohuczy and M.1. Phillips: Designing antisense to inhibit the renin-angiotensin system 143-153 A.R. Brasier, M. Jamaluddin, Y Han, C. Patterson and M.S. Runge: Angiotensin II induces gene transcription through cell-type dependent effects on the nuclear factor-KB (NF-KB) transcription factor 155-169 E. Mascareno and M.A.Q. Siddiqui: The role of Jak/STAT signaling in heart tissue renin-angiotensin system 171-175 R. Aikawa, I. Komuro, R. Nagai and Y Yazaki: Rho plays an important role in angiotensin II-induced hypertrophic responses in cardiac myocytes 177-182 L.M. Khachigian, Y Takuwa and T. Collins: Mechanisms of angiotensin II-induced platelet-derived growth factor gene expression 183-186 H. Matsubara, Y. Moriguchi, Y Mori, H. Masaki, Y Tsutsumi, Y Shibasaki, Y Uchiyama-Tanaka, S. Fujiyama, Y Koyama, A. Nose-Fujiyama, S. Iba, E. Tateishi and T. Iwasaka: Transactivation ofEGF receptor induced by angiotensin II regulates fibronectin and TGF-p gene expression via transcriptional and post-transcriptional mechanisms 187-201 K. Tamura, YE. Chen, Q. Chen, N. Nyui, M. Horiuchi, I. Takasaki, N. Tamura, R.E. Pratt, VJ. Dzau and S. Umemura: Expression of renin-angiotensin system and extracellular matrix genes in cardiovascular cells and its regulation through AT! receptor 203-209 D.H. Wang and I Li: Regulation of angiotensin II receptors in the medullary thick ascending limb 211-218 M. Turcani and H. Rupp: Bradykinin (B) independent effect of captopril on the development ofp ressure overload cardiac hypertrophy 219-225 S. Takeo, Y Nasa, K. Tanonaka, F. Yamaguchi, K.-1. Yabe, H. Hayashi and N.S. Dhalla: Role of cardiac renin-angiotensin system in sarcoplasmic reticulum function and gene expression in the ischemic-reperfused heart 227-235 Index to Volume 212 237-239 Molecular and Cellular Biochemistry 212: 1,2000. © 2000 Kluwer Academic Publishers. Preface This special issue of Molecular and Cellular Biochemistry and angiotensin II influences also become increased. Due focuses on 'Control of Gene Expression by Catecholamines to beta-adrenergic receptor downregulation, depressed cat and the Renin-Angiotensin System' in health and disease. In echolamine influences are expected in the final stage of heart recent years, great progress has been made in the under failure. An imbalanced influence of catecholamines and an standing of catecholamine and angiotensin II modulated giotensin II on gene expression leads to disordered molecular gene expression. There is also increasing evidence that cat structures of the cell and an impaired cell function. echolamine and angiotensin II induced cellular injury not The focused issue is organized into chapters focusing on solely arises from classical pathways but also from a per catecholamines, angiotensin II and the interaction between cat turbed gene expression. echolamines and angiotensin II. Basic biochemical processes Taking into account that catecholamines and angiotensin II are covered in detail and the potential of these pathways are vital for a balanced gene expression of many cells, the for explaining chronic diseases associated with excess cat intriguing possibility arises that various diseases are initiated echolamine and angiotensin II influences should become or aggravated by such an imbalance. Catecholamine and an apparent. It is hoped that the focused issue triggers novel giotensin II influences can be in excess arising from, for research into the development of drugs that are targeted at example, hypercaloric food intake or psychosocial stress. diseases characterized by an imbalanced gene expression During early progression of heart failure, sympathetic activity involving catecholamines and angiotensin II. HEINZ RUPP, Professor of Physiology BERNHARD MAISCH, Professor of Medicine Molecular Cardiology Laboratory Department of Internal Medicine and Cardiology, Philipps University of Marburg Marburg, Germany PART I CATECHOLAMINE INFLUENCES ON GENE EXPRESSION Molecular and Cellular Biochemistry 212: 5--9, 2000. © 2000 Kluwer Academic Publishers. Mechanisms of transcriptional activation of cAMP responsive element-binding protein CREB Philipp Haus-Seuffert and Michael Meisteremst Institute ofM olecular Immunology, Department for Proteinbiochemistry, GSF, Munchen, Germany Abstract The CREB-CREM transcription factors are the main gene regulatory effectors of the cAMP signaling pathway. The investiga tions of this family of transcription factors had a profound impact on the understanding of signaling-induced gene transcrip tion. Here we discuss some key aspects of the underlying biology, review transcriptional activation by CREB proteins through transcription cofactors and present novel insights into the context-and position-specific function ofCREB on complex genes. (Mol Cell Biochem 212: 5-9, 2000) Key words: transcriptional regulation, gene expression, coactivator, repressor Biology CRE although it does not appear to be responsible for its tes tis-specific expression [4]. CREB seems to also function as The cAMP-pathway is a widely used signaling process that an effector of angiotensin II signaling. The stimulatory ef senses and amplifies the response of cells to hormones, fect of angiotensin II depends on a cAMP-responsive element growth factors and neurotransmitters. Among the target pro within the fibronectin promoter [5]. Angiotensin II stimu teins of protein kinase A are the transcription factors CREB lation leads to moderate induction of the CREB protein in and CREM. Gene regulatory programs induced by CREB human mesangial cells. Angiotensin II increases interleukin- control different biological processes (for review see [1]) 6 expression in a dose-dependent manner, which is mediated such as T cell development, spermatogenesis, long term through a cAMP-responsive element in the interleukin-6 pro memory but also the regulation of the blood pressure through moter [6]. As one other example a cAMP-responsive element angiotensin. The latter is the focus of this issue. is found in the tyrosine hydroxylase gene promoter [7]. In this study the CRE proves to be one critical angiotensin 11- responsive element in cultured bone adrenal medullary cells. Angiotensins Regulation of long term memory There is increasing evidence, that the protein CREB is in volved in the biology of the renin-angiotensin system (RAS), which plays an important role in the regulation of the blood A correlation between memory and cAMP pathways became pressure. Expression of the rat angiotensinogen gene is posi first evident in genetic studies. Flies were trained to discrimi tively influenced by CREB in a cAMP-dependent manner nate between two different odors, one accompanied with an [2]. The stimulating effect ofCREB depends on a functional electric shock, and the other not associated with a shock. cAMP-responsive element (CRE), located in the 5' -flanking Chemically mutagenized flies were used to find mutants region of the angiotensinogen gene [3]. The expression of which failed to learn the discrimination between the two testis angiotensin converting enzyme depends on a functional odors without being affected in other characteristics like 10- Address for offPrints: M. Meisterernst, Institute of Molecular Immunology, Department for Proteinbiochemistry, GSF, Marchioninistrasse 25, D-8l3 77 Munchen, Germany 6 comotion or odor detection [8]. Four mutants were found and Activation DNA binding the corresponding genes were identified. Remarkably, three 271aa ATF-l out of four mutants affect molecules that are involved in cAMP signaling [9]. Long term - in contrast to short term 341aa CREB/CREM memory storage depends on transcriptional activity and the / synthesis of new proteins [10]. Studies in Drosophila and Aplysia demonstrated that CREB is critically involved in this PKA process [11]. One model implies that CREB-mediated tran CKII Ser133 CKII scription activates a gene expression program that ultimately 1 1 1 1 1 1 11 1 leads to the production of new synapses between neurons and AESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSA CREB a prolonged stabilization of the synaptic facilitation (see re AEfDDfADfE--VIDfHKRREILfRRPfYRKILNELffDVPGIPKIEEEKfEEEGTP CREM view [12]). CKII CKI GSK-3 Ser117 CKI PKA CKII PKC cdc2 CREB function in the immune system CamK cdc2 S6 ATF/CREB proteins are involved in the development and Fig. 1. Structure of A TF -I, CREB and CREM proteins. The P-box, the function ofT lymphocytes. The signal transduction pathways glutamine-rich domains (QI and Q2) and the DNA binding region (leucine in T cells after T-cell receptor engagement, which lead to zipper and basic domain) are indicated. Sequence alignment of the P-boxes ofCREB and CREM. Serine and threonine residues can be phosphorylated phosphorylation and activation of CREB, include protein by the indicated kinases as marked by arrows. kinases C, RAS, RAF-1, MEK and RSK2 [13]. Functional binding sites for members of the ATF/CREB family were identified in the promoters and enhancers of many T-cell quence, flanking bases are important for binding of CREB specific genes, including the TCR-a and -p enhancers [14, [24]. 15], the CD38 enhancer [16] and the TCR Vp promoters [17]. The members of the CREB family of transcription factors Transgenic models provided strong in vivo evidence for the share structural features within their transactivation domains. importance of CREBIA TF proteins in the immune system. Transcriptional activation is mediated through two regions CREB knock-out mice show defects in the development of (compare Fig. 1). One region contains several recognition specific T-cell lineages [18]. A dominant negative form of motifs for protein kinases. It is therefore called kinase in CREB under the control of the T-cell specific CD2 promoterl ducible domain (KID) or phosphorylation box (P-box). The enhancer leads to a profound defect in T cell proliferation transactivation potential of CREB proteins critically depends after stimulation of the T-cell receptor pathways [19]. on their phosphorylation status [25, 26]. The other constitu tive activation region, contained in CREB and CREM, con sists of two glutamine-rich motifs, called Q1 and Q2, which CREB structure flank the kinase inducible domain [27]. Mammalian ATF-1 lacks Q1 but contains Q2 [28]. Glutamine-rich regions can The CREBIA TF family consists of a large number of genes be found in many regulatory, coactivator and basal transcrip that include the factors CREB, CREM, ATF -1, ATF -2, ATF- tion factors and serve as interaction surfaces for other tran 3 andATF-4 (also known as CREB2). Various splice variants scription factors. It has been suggested that CREB and CREM of each of these proteins have been identified which activate require the P-box and at least one glutamine-rich domain [27, or repress transcription (see review [20]). CREB, first iden 29] to activate transcription. tified [21], is probably one of the most meticulously charac Several isoforms of each member of the CREB family of terized transcription factors in eukaryotes. transcription factors were identified. Glutamine-rich regions A common feature of all the family members is a basic re can be removed via alternative splicing, either partially (in gion leucine zipper (bZIP) domain (Fig. 1). The leucine zip Drosophila CREB2b) or completely (in mammalian CREMa, per consists of an a-helical coiled-coil structure, which forms CREMP and CREMy), with the consequence that these pro homo- and heterodimers. A particular 'dimerization code' teins display repressor function [29]. The insertion of pre determines which heterodimers are possible [22]. The basic mature stop co dons in the CREB gene results in truncated region is responsible for the sequence-specific DNA-bind proteins that lack the DNA-binding region and that also func ing ofthe CREB transcription factors to cyclic AMP-response tion as repressors. In Aplysia, a CREB isoform was identi element (CRE). The cognate DNA-recognition motiffor the fied, which lacks the nuclear localisation signal [30]. This CREB homodimer is a symmetric palindromic motif with se cytoplasmic form (CREB 1c ) regulates the activity ofkinases quence 5'-TGACGTCA-3' [23]. In addition to the core se- that phosphorylate nuclear CREB. 7 Signal-induced activation by CREB be a tissue-specific coactivator for CREM. It possesses an intrinsic activation domain and interacts with CREM in a phosphorylation-independent manner. In addition to the in CREB binding sites had been identified in a multitude of ducible P-box domain, CREB also contains a constitutive inducible promoters. Examples are the somatostatin-[31] and activation domain (CAD), which is responsible for the inter the proenkephaline promoter [32] as well as many others (see action with one or more of the TATA-box associated factors reviews [1,20]) The critical region in CREB for the response (TAFs), one of which is TAF,,110 (the drosophila homolog to cAMP [25] is the phosphorylation box (P-box) or kinase of human TAF,,130). The constitutive activation domain of inducible domain (KID). As depicted in Fig. 1, the P-box CREB can be subdivided into three regions, which are rich contains several consensus phosphorylation sites for kinases in either serine, hydrophobic amino acids, or glutamine. All such as PKA, PKC, glycogen synthase kinase-3 and casein three regions are necessary for effective interaction with kinases (CK) I and II [25] [33]. Upon activation of the ade TAF,,110 in a yeast two-hybrid assay [43]. nylate cyclase pathway, the serine at position 133 of CREB (serine 117 in CREM) is phosphorylated by PKA, which enhances the transcriptional activity of the proteins CREB andCREM. Transcriptional effects of CREB are In addition to PKA, other signal transduction pathways tar context- and position-specific get the CREB protein, in order to either increase or decrease its transcriptional activity. For example, the Ca2+- calmodulin The biological effects of the cAMP pathway through CREB dependent kinase IV (CaMKIV) phosphorylates CREB at are entirely based upon a gene expression program initiated Serl33 after membrane depolarization in neuronal cells [34]. by the activator. Hence, unraveling of CREB transcriptional Also signal transduction pathways triggered by growth fac activation is crucial for the understanding of the biological tors and inflammatory cytokines lead to a phosphorylation processes. Above we have discussed CREB-structure and - ofCREB (see review [35]). Ca2+-calmodulin-dependentkinase function through cofactors. Additional important parameters II (CaMKII) phosphorylates CREB at Ser133 and Serl42. for CREB function are the context in which CREs are em Remarkably, phosphorylation ofSerl42 by CaMKII neutral bedded and the position of CREs relative to the start site of izes the activity of CREB [36]. transcription. This has been most clearly demonstrated on the gene encoding the T-cell receptor beta (TCR~) chain [44]. These studies could have model character for the many other CREB and CREM activate through target genes of cAMP-induced CREB proteins and, therefore, transcription co factors will be briefly reviewed here. The TCR~ gene is an attractive model for the study of pro A breakthrough in the understanding of inducible CREB fun moter and enhancer function. This is mainly based upon the ction came from the discovery of the cofactor CBP (CREB fact that the genome contains many different promoters that binding protein) that interacts specifically with the phospho can be compared. A functional TCR!) gene is generated through rylated CREB P-box domain [37]. In the current model, the recombination events in which the enhancer is brought into cofactor CBP and its close relative p300 serve as bridging the relative vicinity of one of the many V!) promoters (al factors between the activator CREB and the general transcrip though it remains a distal element, several kilobases apart tion factors [27, 38]. These cofactors also possess a histone from the promoter). The rearranged TCR~ gene contains acetyltransferase (HAT) activity, which is thought to playa CREs in three different positions that seem to fullfill alter critical role for gene activation in the chromatin (reviewed native tasks (Fig. 2). Firstly, CREs are contained within the in [39]). CBP and p300 bind to other cofactor complexes distal TCR~ enhancer [15]. Secondly, in many V~ promot among them PCAF, SRC-l!NcoA-l, TIF-2!NcoA-2 and pCIP/ ers one CRE is found in a promoter-proximal position [17], ACTR which also possess histone acetyltransferase activity in between position -1 00 to -40 upstream of the start site of (reviewed in [40]). There are indications for the formation transcription. In our studies of the human V~ 8.1 promoter of gene-and pathway-specific complexes. For example, bind we could also detect a third cryptic CRE within the core pro ing of CBP to PCAF and pCIP has been reported to be neces moter region [44], located in between position -30 and +1 1 sary for induced CREB function [41]. The interaction between (compare Fig. 2). This is the region where TFIID and the cofactors and the P-box of CREB and CREM is not always other general transcription factors bind to the promoter. phosphorylation-dependent. A new route for transcriptional In the enhancer CREB appears to be part of a multiprotein activation by CREB and CREM was reported recently, dem enhanceosome [15]. The enhancer is efficiently repressed by onstrating the functional interaction between ACT (for acti overexpression of the 12S form of adenovirus encoded E 1A , vator of CREM in testis) and CREM [42]. ACT appears to which is known to compete for the CREB-binding proteins 8 CBP and p300. One simple scenario would imply that CBP plexity to the control of cAMP-induced gene activation in binds to and functions via binding to CREB in the enhancer. other biological processes. However, ElA retained its repression potential even after removal of the CRE. Repression by ElA seems to be rather correlated to the overall enhancer activity. This suggests that Acknowledgements CBP is part of, or functions through, the multiprotein en hanceosome rather than through individual activators alone We must apologize to the many researchers whose contribu such as CREB [45]. Further evidence for this hypothesis came tions could not be cited mainly for space limitations. We thank from experiments with multimerized CREs that proved to act Peter Halle (Switch Biotech Inc., Munich) for providing un as a poor enhancer element at a distance (unpublished obser published observations and Barbara Giinzler and Gerhard vations). The promoter-upstream (VAS) CRE mainly serves Mittler (Gene Center, Munich) for their support during prepa as a platform for the enhancer. This is concluded from the fact ration of the manuscript. that it raises relative enhancer activity but displays little in fluence on the promoter [44, 45]. Activation requires an in tact PKA phosphorylation site in CREB. In contrast, the third References functional CRE within the core promoter contributes strongly to V~ 8.1 promoter activity. This low affinity CRE can be ac I. Sassone CP: Transcription factors responsive to cAMP. Annu Rev Cell tivated through overexpression of CREB, but not through a DevBiolll: 355-377, 1995 mutant lacking Ser133. Moreover, replacement of the weak 2. Qian JF, Wang TT, Wu XH, Wu J, Ge C, Lachance S, Carriere S, Chan CRE by a consensus CRE efficiently raises promoter activ JS: Angiotensinogen gene expression is stimulated by the cAMP-re sponsive element-binding protein in opossum kidney cells. J Am Soc ity [44]. Thus, the core CRE is critical for promoter function, Nephrol8: 1072-1079,1997 whereas the two other CREs help to establish a functional 3. Wang TT, Chen X, Wu XH, Zhang SL, Chan JS: Molecular mechanism( s) enhancer. Related mechanisms could add a new level of com- of action of isoproterenol on the expression of the angiotensinogen gene in opossum kidney proximal tubular cells. Kidney Int 55: 1713-1723, 1999 4. Esther CJ, Semeniuk D, Marino EM, Zhou Y, Overbeek PA, Bernstein Enhanccr KE: Expression of testis angiotensin-converting enzyme is mediated by a cyclic AMP responsive element. Lab Invest 77: 483-488, 1997 5. Nahman NJ, Rothe KL, Falkenhain ME, Frazer KM, Dacio LE, Madia 1« JD, Leonhart KL, Kronenberger JC, Stauch DA: Angiotensin II induc tion of fibronectin biosynthesis in cultured human mesangial cells: Association with CREB transcription factor activation. J Lab Clin Med * 127: 599--611,1996 6. Funakoshi Y, Ichiki T, Ito K, Takeshita A: Induction of interleukin-6 CBP/p300 expression by angiotensin II in rat vascular smooth muscle cells. Hy pertension 34: 118-125, 1999 7. Kim EL, Esparza FM, Stachowiak MK: The roles of CRE, TRE, and TRE-adjacent S I nuclease sensitive element in the regulation of tyro sine hydroxylase gene promoter activity by angiotensin II. J N eurochem CHROMATIN 67: 26--36, 1996 8. Dudai Y, Jan YN, Byers D, Quinn WG, Benzer S: Dunce, a mutant of -69 VAS -42 +1 Drosophila deficient in learning. Proc Natl Acad Sci USA 73: 1684- CORE 1688,1976 Promotcl' 9. Dubnau J, Tully T: Gene discovery in Drosophila: New insights for learning and memory. Annu Rev Neurosci 21: 407-444, 1998 Fig. 2. Position depending function ofCREs. The model is based upon the 10. Davis HP, Squire LR: Protein synthesis and memory: A review. Psychol analysis of the TCRP gene consisting of the distal enhancer and the Vp 8.1 Bull 96: 518-559, 1984 promoter. CREs (cAMP-responsive elements) are found within the TCRP II. Dash PK, Hochner B, Kandel ER: Injection of the cAMP-responsive enhancer and the VP8.l promoter. The promoter comprises two CREs up element into the nucleus ofA plysia sensory neurons blocks long-term stream of the core region (upstream activating sequence (UAS)) and within facilitation. Nature 345: 718-721, 1990 the core region (positions -30 to + II). Only the core element affects pro 12. Mayford M, Kandel ER: Genetic approaches to memory storage. moter activity (arrow) whereas the two other elements mainly contribute Trends Genet 15: 463-470, 1999 to enhancer-promoter communication. Possible functional interactions be 13. Muthusamy N, Leiden JM: A protein kinase Co, Ras-, and RSK2-de tween the enhancer and the promoter via the cofactor CBP/p300 are indi pendent signal transduction pathway activates the cAMP-responsive cated by black arrows. The model implies that upon interaction with the element-binding protein transcription factor following T cell receptor enhanceosome CBP and p300 acetylate histones (grey arrow), which could engagement. J BioI Chern 273: 22841-22847, 1998 help to keep the promoter accessible for CREB and other activators that bind 14. Mayall TP, Sheridan PL, Montminy MR, Jones KA: Distinct roles for to weak interaction sites on the core promoter and subsequently activate P-CREB and LEF-I in TCR alpha enhancer assembly and activation transcription. on chromatin templates in vitro. Genes Dev II: 887-899, 1997

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.