ebook img

Coherence and control of quantum registers based on electronic spin in a nuclear spin bath PDF

0.92 MB·English
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Coherence and control of quantum registers based on electronic spin in a nuclear spin bath

Coherence and control of quantum registers based on electronic spin in a nuclear spin bath P. Cappellaro1,2, L. Jiang2, J. S. Hodges2,3 and M. D. Lukin1,2 1ITAMP – Harvard-Smithsonian Center for Astrophysics and 2Physics Department, Harvard University, Cambridge, MA 02138, USA. 3Department of Nuclear Science and Engineering, Massachusetts Institute of Technology, Cambridge, MA 02139, USA We consider a protocol for the control of few-qubit registers comprising one electronic spin em- bedded in a nuclear spin bath. We show how to isolate a few proximal nuclear spins from the rest of the environment and use them as building blocks for a potentially scalable quantum informa- tionprocessor. Wedescribehowcoherentcontroltechniquesbasedonmagneticresonancemethods can be adapted to these electronic-nuclear solid state spin systems, to provide not only efficient, 9 high fidelity manipulation of the registers, but also decoupling from the spin bath. As an exam- 0 ple,weanalyze feasible performances and practical limitations inarealistic settingassociated with 0 nitrogen-vacancy centers in diamond. 2 n Thecoherencepropertiesofisolatedelectronicspinsin the desired interactions among qubits while attempting a J solid-state materials are frequently determined by their to remove the couplings to the environment. The chal- 5 interactions with large ensembles of lattice nuclear spins lenges to overcome are then to resolve individual energy [1,2]. Thedynamicsofnuclearspinsistypicallyslow,re- levelsforqubitaddressabilityandcontrol,whileavoiding ] sultinginverylongcorrelationtimesoftheenvironment. fast dephasing due to uncontrolled portion of the bath. h p Indeed, nuclear spins represent one of the most isolated Before proceeding we note that various proposals for - systems available in nature. This allows, for instance, integrating these small quantum registers into a larger t n to decouple electronic spin qubits from nuclear spins via systemcapableoffaulttolerantquantumcomputationor a spin echo techniques [3, 4]. Even more remarkably, con- communication have been explored theoretically [10, 11] u trolled manipulationof the coupled electron-nuclearsys- andexperimentally [12, 13]. These schemes generallyre- q tem allows one to take advantage of the nuclear spin quire a communication qubit and a few ancillary qubits [ environment and use it as a long-lived quantum mem- per register, in a hybrid architecture. The communica- 1 ory [5, 6, 7]. Recently, this approach has been used to tion qubits couple efficiently to external degrees of free- v demonstrate a single nuclear qubit memory with coher- dom (for initialization, measurement and entanglement 4 4 ence times well exceeding tens of milliseconds in room distribution), leading to aneasy controlbut alsofastde- 4 temperature diamond [8]. Entangled states composed phasing. The ancillary qubits instead are more isolated 0 of one electronic spin and two nuclear spin qubits have and can act as memory and ancillas in error correction . 1 been probed in such a system [9]. The essence of these protocols. While our analysis is quite general in that it 0 experiments is to gain complete control over several nu- appliestoavarietyofphysicalsystems,suchasquantum 9 clei by isolating them from the rest of the nuclear spin dotsincarbonnanotubes[14]orspinimpuritiesinsilicon 0 bath. Universal control of systems comprising a single [7], as a specific example we will focus on the nitrogen- : v electronic spin coupled to many nuclear spins has not vacancy (NV) centers in diamond [4, 8, 9]. These are i X been demonstrated yet and could enable developing of promising systems for the realizationof hybrid quantum robust quantum nodes to build larger scale quantum in- networksduetotheirlongspincoherencetimesandgood r a formation architectures. optical transitions that can be used for remote coupling In this Letter, we describe a technique to achieve co- between registers [15]. herent universal control of a portion of the nuclear spin To be specific, we focus on an electronic spin triplet, environment. Inparticular,weshowhowseveralofthese as it is the case for the NV centers. Quantum informa- nuclear spins can be used, together with an electronic tion is encoded in the m ={0,1} Zeeman sublevels, sep- s spin,tobuildrobustmulti-qubitquantumregisters. Our arated by a large zero field splitting (making m a good s approach is based on quantum control techniques asso- quantum number). Other Zeeman sublevels are shifted ciated with magnetic resonance manipulation. However, off-resonance by an external magnetic field B , applied z there exists an essential difference between the proposed along the N-to-V axis. The electron-nuclear spin Hamil- systemandother previouslystudied smallquantum pro- tonian in the electronic rotating frame is cessors,such as NMR molecules. Here the boundary be- ttwimeaenteltyhediqcutabtitesdibnytohuersyabstielimtyatnodeffthecetibvaetlhy csponintsroilstuhle- H= =11−ωSLzωPIzj +IjS+zP11+ASzj ·I~j~ω+j ·HI~jdi+p H (1) 2 LP z 2 P 1 dip qubits. The interactions governing the couplings of the electronicspinto the nuclearqubit andbathspins areof where S and Ij are the electronic and nuclear spin oper- the same nature, so that control schemes must preserve ators,ω is the nuclearLarmorfrequency,A the hyper- L j 2 A B |hh〉 4 A |hi〉 |ei • H • H • H • H • 3 C1 C3 |ms=1〉 |ih〉 |C1i • = X Z Z X C2 e-V Bz 2 |C2i U U N C4 ESR |ii〉 B 41 |ei U = C • B • A X • X • α frozen core |ms=0〉 |Ci • Z Z Φα Φα FIG. 1: a) System model, showing the electronic spin in red FIG. 2: Circuits for controlled gates U among two nuclear and the surrounding nuclear spins. The closest nuclear spins spins(A)andanuclearandtheelectronicspin(B).Thegates are used as qubits. Of the bath spins, only the spins outside A,B,CaredefinedsuchthatU =eiαAZBZCandABC =11, the frozen core evolve due to dipolar interaction, causing de- where Z is a π rotation around z [26]. Φα is a phase gate: coherence. b)Frequencyselectivepulses,ina3-qubitregister. |0ih0|+|1ih1|eiα/2 and the gate α indicates eiα/211. rf power provides sufficiently fast rotations since the hy- fine couplings and H the nuclear dipolar interaction, dip perfine interaction enhances the nuclear Rabi frequency whose strenght can be enhanced by the hyperfine inter- when m =1 [24]. Any other gate needed for universal s action [18]. When the electronic spin is in the m =1 s control can be obtained combining these two gates. For state, nearby nuclei are static (since distinct hyperfine example,itispossibletoimplementasinglenuclearqubit couplings make nuclear flip-flops energetically unfavor- rotationbyrepeatingthecontrolledgateafterapplyinga able in the so-called frozen core [16]) and give rise to π-pulse to the electronic spin. Controlled gates between a quasi-static field acting on the electronic spin. The two nuclei can be implemented by taking advantage of other bath nuclei cause decoherence via spectral diffu- the stronger coupling to the electron as shown in Fig. sion [17, 18], but their couplings, which determine the 2(A). As long as the hyperfine coupling is several times noise strengthand correlationtime, are ordersofmagni- largerthanthenuclearcoupling,theschemeavoidingany tude lower than the interactions used to control the sys- direct nuclear interaction is faster. Although selectively tem. While in the m =0 manifold all the nuclear spins s addressing ESR transitions is a direct way to perform a precess at the same frequency, the effective resonance controlled rotation with the electronic spin as a target, frequencies in the m =1 manifold, ωj, are given by the s 1 this isinefficientasthe numberofnuclearspinincreases. hyperfine interactionandthe enhancedg-tensor [18, 19], The circuit in Fig. 2(B) performs the desired operation yieldingawiderangeofvalues. Someofthenuclearspins with only the two proposed gates on a faster time scale. in the frozen core can thus be used as qubits. When fix- When working in the m =1 manifold, each nuclear s ing the boundary between system and environment we spin qubit is quantized along a different direction and have to consider not only frequency addressability but we cannot define a common rotating frame. The evolu- alsoachievablegatetimes,whichneedtobeshorterthan tion must be described in the laboratory frame while the the decoherence time. control Hamiltonian is fixed in a given direction for all Control is obtained with microwave (µw) and radio- thenuclei(e.g. alongthex-axis). Thisyieldsareducedrf frequency (rf) fields. The most intuitive scheme, per- RabifrequencyΩ¯ =Ω cosϕ 2cosθ 2+sinϕ 2(where formingsingle-qubitgateswiththesefieldsandtwo-qubit rfp 1 1 1 {θ ,ϕ }definelocalquantizationaxesinthem =1man- 1 1 s gates by direct spin-spin couplings, is relatively slow, ifold and Ω is the hyperfine-enhanced Rabi frequency). rf since rf transitions are weak. Another strategy, requir- The propagator for a pulse time t and phase ψ is p ingonlycontroloftheelectronicspin,hasbeenproposed [20, 21]: switching the electronic spin between its two U (Ω ,t ,ψ)=e−i[ωtp−(λ−ψ)]σz˜/2e−iΩ¯tpσx˜/2e−i(λ−ψ)σz˜/2 L rf p Zeemaneigenstatesinducesnuclearspinsrotationsabout twononparallelaxesthatgenerateanysingle-qubitgate. where {σx˜,σy˜,σz˜} are the Pauli matrices in the local This strategy is not the most appropriate here, since ro- frame and λ is defined by tan(λ) = tanϕ1/cosθ1. An tations in the ms=0 manifold are slow [22]. We thus arbitrary gate U = Rz˜(γ)Rx˜(β)Rz˜(α) can be obtained propose another scheme to achieve universal control on by combining UL with an echo scheme (Fig. 3), which the register,using only two types of gates: 1) One-qubit notonlyrefocusesthe extrafree evolutiondue tothe lab gates on the electronic spin and 2) Controlled gates on frame transformation, but also sets the gate duration to eachofthenuclearspins. Thefirstgatecanbesimplyob- any desired clock time common to all registers. Fixing a tainedbyastrongµwpulse. Thecontrolledgatesareim- clock time is advantageous to synchronize the operation plemented with rf-pulses on resonance with the effective of many registers. This yields a minimum clock time frequency of individual nuclear spins in the ms=1 man- T ≥4π×MaxΩ¯j,ω1j{Ω¯−j1+(ω1j)−1}. ifold, which are resolved due to the hyperfine coupling In order to refocus the fast electronic-spin dephasing and distinct from the bath frequency [23]. Achievable givenbythe frozencorenuclearspins,weneedto embed 3 τ-t τ τ τ-t τ+t τ τ τ+t -t tp tπ t1 tπ t2 rf ϕ ϕ ϕ ϕ p rf t t t t t p π π π π ψ1=α−λ ψ2=π−λ µw T T FIG. 3: Rfpulse scheme for 1 nuclearspin gate in the m =1 s manifold. Withtp=β/Ω¯ andfixingψ1=α-λandψ2=π-λ,the FIG. 4: rf and µw pulse sequence to implement a 1 nuclear time delays are t1=T2 −tp−tπ− α+ωγ and t2=T2 −tπ+α+ωγ. spin gate while reducing the effects of a slowly varying elec- tronic dephasing noise. The black bars indicate π-pulses, while the first rectangle indicate a general pulse around the the control strategy described above in a dynamical de- x-axis. τ = T8 − t2π and tϕ= α4+ωγ. couplingscheme[27]withoutloosinguniversalcontrol,as explained in the following. The electron-bath Hamilto- nm[16]andonlyspinswithhyperfinecoupling.2.5kHz nianisgivenbyEq. (1),wheretheindexj nowrunsover contribute to spectral diffusion. Both the inverse cor- thespinsinthebath. Neglectingforthemomentthecou- relation time (given by the dipolar coupling among car- plingsamongnuclei,wecansolvefortheevolutionofthe bon spins) and the noise rms (given by the coupling to electronic spin under an echo sequence. By defining U 0 the electron) are of order of few kHz. Dynamical decou- and U the propagators in the 0 and 1 manifold respec- 1 pling schemes must thus act on time scales of hundreds tively and assuming that the nuclear spins are initially of µs. This in turns sets achievable constraints on the in the identity state (high temperature regime), we cal- gate speed. culate the dynamics of the electronic spin, ρe(t) = [11+ The time of a conditional single nuclear spin rota- (|0ih1|f (t)+h.c.)]ρ (0),wheref (t)=Tr U U U†U† ee e ee h 1 0 1 0i tion must be set so that the Rabi frequency Ω is much rf = Q[1−2sin2(θ1j)sin2(ω1jt/2)sin2(ωLt/2)] is the func- less than the frequency splitting between two neighbor- tion describing the echo envelope experiments [19, 28]. ing spins (in terms of frequencies). Suppose we want Since in the ms=0 subspace all the spins have the same to control an n-spin register without exciting bath spins frequency,fee(2nπ/ωL)=0andthe electroncomesback at the Larmor frequency. The minimum frequency split- to the initial state. Nuclear spin-spin couplings lead to ting between two nuclei in the m =1 manifold will be s an imperfect echo revival and ultimately to decoherence at best δω = ωM for nuclear frequency equally spaced n via spectral diffusion [17, 18]. The energy-conserving andω themaximumhyperfine-inducedeffectivenuclear M flip-flops of remote nuclear spins modulate the hyperfine frequency. The nuclear frequency spread due to the hy- couplings, causing the effective field seen by the electron perfine interaction is then ∆E = n+1ω . We want N 2 M to vary in time. The field oscillations can be modeled the Rabi frequencies to satisfy the constraints: ∆E ≫ e by a classical stochastic process. The overall evolution Ω ≫ n+1ω > ωM ≫ Ω , where ∆E = 2gµ B is e 2 M n rf e B z of the electronic spin is therefore due to two processes the gap to other Zeeman levels (m =−1 for the NVc) s that can be treated separately as they commute: the andΩ the µw power. Fora typicalchoiceof700Gmag- e echo envelope calculated above and the decay due to a netic field along the NV axis, we have ∆E =2GHz and e stochastic field, approximated by a cumulant expansion ω =0.8MHz. Assuming ω ≈20MHz andn=4 spins, L M [29]. ForaLorentziannoisewithautocorrelationfunction we obtain the following parameter window (in units of G(τ) =G0e−t/τc we obtain a spin-echo decay ∝e−23Ωτc2t3 MHz) 2000 ≫ Ωe ≫ 25, Ωrf ≪ 5. The gate clock time fort≪τ (orthemotionalnarrowingregimeforτ ≪t). can be as short as a few µs, allowing hundreds of gates c c in the coherence time. Byusingdynamicaldecouplingtechniques[30]andse- lecting a cycle time multiple of the bare larmor preces- Sincetheschemepresentedisbasedonselectivepulses, sion period it is possible to extend the life-time of the the most important (coherent) errors will be due to off- electroniccoherence. Figure4showshowtocombinethe resonance effects. If the Rabi frequency is much smaller electronmodulationwiththesequenceimplementingspin than the off-set from the transmitter frequency δω, the gates. The effectiveness of these techniques relies on the off-resonance spin will just experience a shift (Bloch- ability to modulate the evolution ona time scale shorter Siegert shift) of its resonance frequency, ∆ωbs = δω − thanthenoisecorrelationtime. Thenoiseoftheelectron- 1 Ω (t)2+δω2 dt′ ≈−Ω2rf =−nΩ2rf. This results in t R p rf 2δω 2ωM nuclear spinsystem is particularly adaptto these decou- an additional phase acquired during the gate time that plingschemes. ConsiderforexampletheNVcenter. The needs to be refocused. Note that this error grows with measuredelectrondephasingT∗timeisabout1µsinnat- the register size and constrains Ω . When reducing the 2 rf uraldiamonds [19], asexpected fromMHz-stronghyper- Rabi frequency to achieve frequency selectivity, we have fine couplings. The intrinsic decoherence time T can be to pay closer attention to the rotating-wave approxima- 2 orders of magnitude longer (T & 600µs). This reflects tion and consider its first order correction, which pro- 2 the existence of a frozen region, where the spin flip-flops ducesashiftoftheon-resonancespin∆ωrwa =Ω2rf/4ωM. are quenched. The radius ofthis frozencoreis about2.2 Othersourcesoferrorsareevolutionofbystandernuclear 4 spins and couplings among spins. More complex active anumberofabout50possiblenuclearsiteswithhyperfine decoupling schemes [31, 32, 33] can correct for these er- values from 15MHz to 1MHz. Even if the concentration rors, allowing to use the m =1 manifold as a memory. of C-13 is increased (and the Nitrogen nuclear spin is s Advanced techniques like shaped pulses, with ampli- used) the size of the register will be limited to about 10 tude and phase ramping, composite pulses [34], pulses spins. Nevertheless such registers would be very useful optimized via optimal control theory or with numerical for memory storage and error correction purposes. techniques [35, 36, 37] can provide better fidelity. The In conclusion, we have presented a general approach analyticalmodelofcontrolservesthenasaninitialguess to the control of a small quantum system comprising an for the numericalsearches. Pulses found in this way cor- electronic spin and few nuclear spins in the surround- rectforthecouplingsamongnucleiandarerobustovera ing spin bath. We have shown that several of the bath widerangeofparameters(suchasexperimentalerrorsor spins can be isolated and effectively controlled, yielding thenoiseassociatedwithstaticfields). TableIshowsthe a few-qubit register. These registers can be employed results of simulations in a fictitious NV system with 1-4 in many proposals for distributed quantum computa- nuclearspinsandeffectivefrequenciesinthems=1man- tionandcommunication,wherecouplingamongregisters ifoldrangingfrom15to2MHz. Wesearchednumerically could be provided either via photon entanglement [15] viaaconjugategradientalgorithmforacontrolsequence or by a movable reading tip [39]. Our control methods performing a desired unitary evolution, by varying the enable algorithms needed for errorcorrectionand entan- amplitude and phase of the µw and rf fields. We then glement purification, while the nuclear spins provide a simulated the control sequence in the presence of noise, long-time memory in the m = 1 manifold, via active s withcontributionsfromalarge,staticfieldandasmaller refocusing,andtheelectrondephasingiskeptundercon- fluctuating one. The projected fidelities in the absence trolby dynamical decoupling methods. We thus develop of experimental errorsare very high, a sign that the fast amodularcontrolscheme,scalabletomanyregistersand modulation of the electron evolution effectively decou- applicable to many physical implementations. ples it from the bath. The pulse robustness with respect Acknowledgments. Thisworkwassupportedbythe to the noise is slightly degraded as the number of spins NSF,ITAMP,DARPAandtheDavidandLucilePackard increases: the noise induces a spread of the electron res- Foundation. onance frequency, and it becomes more difficult to find a sequence of control parameters that drives the desired evolutioninthislargerHilbertspaceforanyofthepossi- bleelectronicfrequency. Thefidelitydegradationishow- evermodest,andcanbepartiallycorrectedbyincreasing [1] W.A.CoishandD.Loss,Phys.Rev.B70,195340(2004). [2] F. H.L. Koppenset al., Science p.1113719 (2005). the controlfieldintensity. Furthermore,combiningthese [3] Petta, J. R. et. al, Science 309, 2180 (2005). pulses in a dynamical decoupling scheme would provide [4] R. Hanson et al., Science 320, 352 (2008). an efficient way to coherently control the registers. [5] J.M.Taylor,C.M.Marcus,andM.D.Lukin,Phys.Rev. Lett. 90, 206803 (2003). 1 spin 2 spins 3 spins 4 spins [6] M. Mehring,J. Mende,Phys.Rev.A73, 052303 (2006). [7] J. J. L. Morton et al.,Nature 455, 1085–1088 (2008). F (ideal) 0.9999 0.9999 0.9992 0.9995 [8] M.V.G. Dutt et al., Science 316 (2007). F (noise) 0.9994 0.9995 0.9975 0.9925 [9] P. Neumann et al., Science 320, 1326 (2008). time 5.0 µs 5.5 µs 6.0 µs 8.5 µs [10] L.Jiang,J.M.Taylor,A.S.Sorensen,andM.D.Lukin, Phys. Rev.A 76, 062323 (2007). TABLE I: Simulated fidelities (F = |TrˆUw†U˜/2N|2) at the [11] E. T. Campbell, Phys. Rev.A 76, 040302 (2007). optimal gatetime inthepresenceof noise. Thegateis aπ/2 [12] K. M. Birnbaum, et al, Nature 436, 87 (2005). rotation about the local x-axis for qubit 1 in a register of 1– [13] D.L. Moehring et al., Nature 449, 68 (2007). 4 nuclear qubits. The noise parameters are T∗ = 1.5µs and [14] N. Mason, M. J. Biercuk, and C. M. Marcus, Science 2 T2 =250µs; the maximum Rabi frequencies are 2π×10MHz 303, 655 (2004). and 2π×20kHz for the electronic and nuclear spins respec- [15] L. Jiang et al., Phys. Rev. Lett. 100, 073001 (2008). tively. As expected, the optimal gate time increases with E. Togan et al., APS Meeting Abstracts, L2089 (2008). theregistersize,reflectingboththemorecomplexcontrolre- [16] G. R.Khutsishvili, Sov.Phys. Uspekhi 11, 802 (1969). quiredinalargerHilbertspaceandtheweakerhyperfinecou- [17] W.M.Witzel,R.deSousa,andS.D.Sarma,Phys.Rev. plings to more distant spins. Similar fidelities were obtained B 72, 161306 (2005). for a CNOT gate between spin 1 and 2. [18] J. R. Maze, J. M. Taylor, and M. D. Lukin, arXiv:0805.0327 (2008). [19] L. Childress, et al., Science 314, 281 (2006). The size of the register is eventually limited by the [20] J. S. Hodges, J. C. Yang, C. Ramanathan, and D. G. number of available nuclear spins with a hyperfine cou- Cory, Phys. Rev.A 78, 010303 (2008). plingstrongenoughtobeseparatedfromthebath. From [21] N. Khaneja, Phys. Rev.A 76, 032326 (2007). experiments and ab-initio calculation [38] we expect hy- [22] The rotation rates are faster for large external fields, perfinecouplingsof∼130MHzinthefirstshell,andthen which howeverreducetheangle between thetwo axesof 5 rotations, thus increasing the number of switchings and [30] P.Cappellaro,J.S.Hodges,T.F.Havel,andD.G.Cory, thegate time. J. Chem. Phys. 125, 044514 (2006). [23] This leaves open the possibility to operate on the bath [31] J.A.JonesandE.Knill,J.Magn.Res.141, 322(1999). spins toimplement collective refocusing schemes. [32] D. W. Leung, I. L. Chuang, F. Yamaguchi, and Y. Ya- [24] The rf field, being perpendicular to the electronic zero- mamoto, Phys. Rev.A 61, 042310 (2000). field splitting, is enhanced by second order electron- [33] M. D.Bowdrey, J.A.Jones, E. Knill, andR.Laflamme, nuclear cross-transition [25]. Phys. Rev.A 72, 032315 (2005). [25] A. Abragam, B. Bleaney, Electron Paramagnetic Reso- [34] M.H.Levitt,Prog.Nucl.Mag.Res.Spect.18,61(1986). nance of Transition Ions (Clarendon Press, 1970). [35] E.M.Fortunatoetal.,J.Chem.Phys.116,7599(2002). [26] M.A.Nielsen,I.L.Chuang,Quantum Computation and [36] N. Khaneja et al, J. Magn. Res. 172, 296 (2005). Quantum Information (Cambridge Univ.Press, 2000). [37] C. A.Ryan aet al., Phys.Rev. A 78, 012328 (2008). [27] L.ViolaandE.Knill,Phys.Rev.Lett.90,037901(2003). [38] A. Gali, M. Fyta, and E. Kaxiras, Phys. Rev. B 77, [28] L. G. Rowan, E. L. Hahn, and W. B. Mims, Phys. Rev. 155206 (2008). 137, A61 (1965). [39] J.M.Tayloretal.,Nat.Phys.4,810(2008); J.R.Maze [29] R.Kubo, Fluctuation, relaxation and resonance in mag- et al.,Nature 455, 644 (2008). netic system (Oliverand Boyd,Edinburgh,1961).

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.