BLR1 Ligand/ BCA-1/BLC Reinhold Fo¨ rster* Molecular Tumor Genetics and Immunogenetics, Max-Delbruck-Center for Molecular Medicine, Robert Rossle Street 10, Berlin, 13092, Germany *corresponding author tel:+49-30-9406-3330, fax:+49-30-9406-3884, e-mail: [email protected] DOI: 10.1006/rwcy.2000.10011. SUMMARY indicates that this chemokine is the major regulator of B cell migration to and within lymphoid follicles in most secondary lymphoid organs during normal The CXC chemokine BLC/BCA-1 is constitutively immune surveillance. expressedinlymphoidfolliclesofsecondarylymphoid organs. It binds to the chemokine receptor CXCR5, which is found on mature B cells and a small sub- Alternative names population of T memory cells. By attracting B cells, BLC/BCA-1 essentially contributes to B cell homing BLR1 ligand andproperpositioningofthesecellswithinthemicro- anatomic compartments of secondary lymphoid organs. GENE AND GENE REGULATION BACKGROUND Accession numbers Discovery GenBank/EMBL: Human BLC/BCA-1: AF044197, AJ002211 Two groups succeeded in identifying a novel member Mouse BLC/BCA-1: AF044196 of the CXC chemokine family by searching the EST DNA sequences used for cloning mouse BLC/ expressedsequencetag(EST)databasefortranscripts BCA-1: IMAGE Consortium Clone 596050 with sequence motifs characteristic for chemokines. EST DNA sequences used for cloning human BLC/ Since it strongly attracts B lymphocytes, this chemo- BCA-1:T39765,AA298459,T55152;sequence-tagged kine has been termed B lymphocyte chemoattractant side (STS) for chromosomal localization of human (BLC) (Gunn et al., 1998) and B cell-attracting BLC/BCA-1: G14456 chemokine (BCA) 1 (Legler et al., 1998). Both mig- ration and calcium mobilization assays demonstrate Chromosome location that BLC/BCA-1 specifically bindsto an orphanche- mokine receptor formerly known as BLR1 (Dobner et al., 1992). In accordance with the current nomen- The human BLC/BCA-1 gene is located on chromo- clature, BLR1 was consequently termed CXCR5. some 4q21 and is thus in close proximity to most BLC/BCA-1 is constitutively expressed in the B cell- CXC chemokines including IL-8, GRO, and IP-10. rich zone of most secondary lymphoid organs. This The cDNA contains an open reading frame of 327 finding, together with the characteristic phenotype nucleotides encoding a putative protein of 109 amino of CXCR5-gene targeted mice (Fo¨rster et al., 1996), acids with a predicted leader sequence consisting of 1126 Reinhold Fo¨rster 21 and 22 amino acids in mice and humans respec- Important homologies tively. In both species, the secreted protein contains four cysteines at positions characteristic for members Theaminoacidsimilaritybetweenhumanandmurine of the CXC chemokine family. Expression of BLC/ BLC/BCA-1 is 64% as compared with 24–34% for BCA-1 has been identified in spleen, lymph nodes, otherCXCchemokines.Interestingly,aproteincoded Peyer’s patches, and liver (Gunn et al., 1998; Legler for by Mareks disease virus (MDV), Meq-sp, shows et al., 1998). the highest similarity to human and murine BLC/ BCA-1. MDV, a lymphotropic herpesvirus, causes a Relevant linkages lethaldiseaseinchickenswhichischaracterizedbyan initial lytic infection of B cells and the subsequent development of T cell lymphomas (Gunn et al., 1998; CXCR5. Legler et al., 1998). PROTEIN CELLULAR SOURCES AND Accession numbers TISSUE EXPRESSION Cellular sources that produce Mouse BLC/BCA-1: AF044196 Human BLC/BCA-1: AF044197, AJ002211 Northern blot analysis demonstrates that expression of BLC/BCA-1 is restricted to the liver and to Sequence secondary lymphoid organs such as spleen, lymph nodes,andappendix.Incontrast,noexpressioncould See Figure 1. beobservedinthethymusandthebonemarroworby any nonlymphoid organs (Gunn et al., 1998; Legler et al., 1998). In situ hybridization reveals that this Description of protein chemokine is expressed in a reticular pattern. In the spleen it is expressed in the B cell follicles and at BasedoncDNAanalysis,anopenreadingframethat the marginal zone. In Peyer’s patches, expression is encodes a putative protein of 109 amino acids has greatest in the germinal centers, but also extends into been identified in mice and humans. Murine BLC/ the surrounding mantle zone. A similar expression BCA-1 contains a predicted leader peptide of 21 pattern could be observed in lymph nodes but, amino acids, whereas in humans a predicted leader interestingly,expressionisvariableandnotseeninall peptide of 22 amino acids has been found. Thus the follicles (Gunn et al., 1998). The reticular expression predictedsecretedproteinconsistsof88(murine)and patternandthefollicularlocalizationstronglysuggest 87 (human) amino acids. that follicular dendritic cells (FDCs) may be a source Figure 1 Alignment of the protein sequence of murine and human BLC/BCA-1. The putative leader sequences are underlined. Identical amino acids are indicated by asterisks. Sequence Human BLC/BCA-1: SIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNK BLR1 Ligand/BCA-1/BLC 1127 of this chemokine. Expression of BLC/BCA-1 is constitutive expression of BLC/BCA-1 in lymphoid strongly reduced in the spleen of RAG1-deficient follicles and its marked chemotactic activity towards mice.Astheseanimalsaredeficientinlymphocytes,it Bcells,itseemslikelythatBLC/BCA-1contributesto seems likely that lymphocytes provide a signal that the development of B cell areas in some secondary stimulates constitutive expression of BLC/BCA-1 in lymphoid organs. This view is supported by the nonlymphoid cells of the spleen and other lymphoid observedphenotypeofgene-targetedmicelackingthe organs. chemokine receptor CXCR5. These animals show morphologically altered B cell follicles and impaired B cell migration in spleen and Peyer’s patches RECEPTOR UTILIZATION (Fo¨rster et al., 1996). CXCR5 is the only receptor for BLC/BCA-1 identified so far. References Barella, L., Loetscher, M., Tobler, A., Baggiolini, M., and IN VITRO ACTIVITIES Moser, B. (1995). Sequence variation of a novel heptahelical leucocyte receptor through alternative transcript formation. Biochem.J.309,773–779. In vitro findings Dobner, T., Wolf, I., Emrich, T., and Lipp, M. (1992). Differentiation-specificexpressionofanovelGprotein-coupled InvitromigrationassayshaveshownthatBLC/BCA- receptorfromBurkitt’slymphoma.Eur.J.Immunol.22,2795– 2799. 1attractsBlymphocyteswithhighefficacy.However, Fo¨rster,R.,Mattis,E.A.,Kremmer,E.,Wolf,E.,Brem,G.,and as high concentrations of the chemokine (1mM) are Lipp,M.(1996).Aputativechemokinereceptor,BLR1,directs needed to induce maximal migration, it has relatively B cell migration to defined lymphoid organs and specific low potency. Compared with the potent effect ob- anatomiccompartmentsofthespleen.Cell87,1037–1047. servedonBcells,BLC/BCA-1inducesaweakchemo- Fo¨rster, R., Emrich, T., Kremmer, E., and Lipp, M. (1994). Expression of the G-protein-coupled receptor BLR1 defines tactic response in T cells and macrophages, but is mature recirculating B cells and a subset of T memory helper completelyinactiveonneutrophils(Gunnetal.,1998; cells.Blood84,830–840. Legler et al., 1998). The differential responsiveness Gunn, M. D., Ngo, V. N., Ansel, K. M., Ekland, E. H., ofdefinedleukocytesubsetstostimulationwithBLC/ Cyster, J. G., and Williams, L. T. (1998). A B-cell homing BCA-1 correlates with the expression pattern of chemokine made in lymphoid follicles activates Burkitt’s lym- phomareceptor-1.Nature391,799–803. CXCR5.Thischemokinereceptorhasbeenidentified Kaiser,E.,Fo¨rster,R.,Wolf,I.,Ebensperger,C.,Kuehl,W.M., on mature B cells and small subsets of CD4+ and andLipp,M.(1993).TheGprotein-coupledreceptorBLR1is CD8+Tcells(Dobneretal.,1992;Kaiseretal.,1993; involvedinmurineBcelldifferentiationandisalsoexpressedin Fo¨rster et al., 1994) and as a variant form on mono- neuronaltissues.Eur.J.Immunol.23,2532–2539. cytes (Barella et al., 1995). Upon stimulation with Legler, D. F., Loetscher, M., Roos, R. S., Clark-Lewis, I., Baggiolini,M., and Moser, B. (1998). B cell-attracting chemo- BLC/BCA-1, CXCR5-transfected cells respond with kine1,ahumanCXCchemokineexpressedinlymphoidtissues, a transient rise of intracellular (Ca2+). In contrast, selectively attracts B lymphocytes via BLR1/CXCR5. J. Exp. peripheral blood B cells do not respond with Med.187,655–660. intracellular Ca2+ mobilization when activated with this chemokine. This observation suggests that chemokine receptors might couple to different sig- LICENSED PRODUCTS naling pathways in B cells compared with other leukocytes. Recombinant proteins are available from R&D Systems and Peprotech. IN VIVO BIOLOGICAL ACTIVITIES OF LIGANDS IN ANIMAL MODELS Normal physiological roles The biological activities of this chemokine have not yet been studied in vivo. However, based on