ebook img

ACI Materials Journal 2010: Vol 107 Index PDF

2010·5.6 MB·English
by  
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview ACI Materials Journal 2010: Vol 107 Index

ACI MATERIALS JOURNAL INDEX VOLUME 107, 2010 From a Journal of the American Concrete Institute, January through December 2010 > a4\ American Concrete Institute® Advancing concrete knowledge AMERICAN CONCRETE INSTITUTE, Farmington Hills, Michigan ACI Materials Journal/March-April 2011 IND) =, ACI Materials Journal VOLUME 107, 2010 Alkali-silica reaction Remove this section and include it with your January through —Correlation of Reaction Products and Expansion Potential in Alkali- December 2010 Volume 107 issues of the AC/ Materials Silica Reaction for Blended Cement Materials (107-M44) Bonakdar, A.; Journal. Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug. 2010 ........ 380 —lInvestigation of Alkali-Silica Reaction Inhibited by New Lithium Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; Tang, M.; A Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010...................37 Alternative cementitious material Synergistic Effect between Glass Frit Accelerated hydration Potential Approach to Evaluating Soundness of and Blast-Furnace Slag (107-M11) Laldji, S.; Phithaksounthone, A.; and Concrete Containing MgO-Based Expansive Agent (107-M13) Mo, L.; Tagnit-Hamou, A., Jan.-Feb. 2010 . . Deng, M.; and Tang, M., Mar.-Apr. 2010 wi ssc iaectae aoa Aluminosilicate Effect of Mixture Compositions on Workability and Accelerated test Design and Research on Gradient Guemen Concrete Strength of Fly Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., Based on Volumetric Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; and Sun, P., Nov.-Dec. 2010. . Gan, W.-Z.; and Xian, Z.-W., Nov.-Dec. 2010 ey . 611 Amplitude factor Characterization of Deep Surface-Opening Cracks in Accelerometer Compacted Sand Concrete in Pavement Construction: An Concrete: Feasibility of Impact-Generated Rayleigh-Waves (107-M36) Economical and Environmental Solution (107-M24) El Euch Khay, S.; Chai, H. K.; Momoki, S.; Aggelis, D. G.; and Shiotani, T., May-June Neji, J.; and Loulizi, A., Mar.-Apr. 2010 a 195 2010 Active protection Corrosion Protection of Fiber- Reinforced Polymer- Analysis ofM ortar Long-Term Strength with Supplementary Cementitious Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Materials Cured at Different Temperatures (107-M37) Ezziane, K.; Malhotra, S. N., July-Aug. 2010... 349 Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug. 2010. ..... . 323 Admixture(s) Anderson, M. A. Detection of Aggregate Clay Coatings and Impacts on —Effect of Calcium Chloride and Initial Curing Temperature on Expansion Concrete (107-M45) July-Aug. 2010 ...............2022-0000-- 387 Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and Kurtis, K. E., Andion, L. G. Triple Percolation in Concrete Reinforced with Carbon Fiber Nov.-Dec. 2010 : iis a (107-M46) July-Aug. 2010 . ate n'a tie gt alsa elei te as ren eae —Effects of Hauling Time on Air- Entrained Self- co nsolidating Concrete Ann, K. Y. (107-M32) Ghafoori, N., and Barfield, M., May-June 2010. . . . 275 —Critical Corrosion Threshold of Galvanized Reinforcing Bars (Disc. 106-M22) Aggelis, D. G. Jan.-Feb. 2010 —Characterization of Deep Surface-Opening Cracks in Concrete: Feasibility of Impact-Generated Rayleigh-Waves (107-M36) May-June CF Coe re EE, BOO ccicbacewsc eounucessennd e 2010 ; 305 Anodic current Corrosion Protection of Fiber-Reinforced Polymer- —Numerical Simulation of Stress Waves on Surface of Strongly Heterogeneous Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Media (107-M53) Sept.-Oct. 2010 469 oe eeee e ee Aggregate(s) Artificial Neural Network Modeling of Early-Age Dynamic Young’s —Artificial Neural Network Modeling of Early-Age Dynamic Young’s Modulus of Normal Concrete (107-M33) Venkiteela, G.; Gregori, A.; Modulus of Normal Concrete (107-M33) Venkiteela, G.; Gregori, A.; Sun, Z.; Sun, Z.; and Shah, S. P.. May-Jume 2010... cece cccr ences s O00 and Shah, S. P., May-June 2010 . -2 82 Asphalt emulsion Temperature Stability of Compressive Strength of —Effect of Aggregate Type on Mechanical Properties of Reactive Powder Cement Asphalt Mortar (107-M04) Wang, F.; Liu, Z.; Wang, T.; and Hu, S., Concrete (107-MS0) Aydin, S.; Yazici, H.; Yardimci, M. Y.; and Yigiter, H., Jan.-Feb. 2010. Sept.-Oct. 2010.......... nani eee Assessing Mechanical Properties and Microstructure of Fire-Damaged —Effect of Curing Methods on pategpenes Siuteings ond Self-Induced Engineered Cementitious Composites (107-M35) Sahmaran, M.; Stresso f High-Performance Concrete (107-M10) Meddah, M. S., and Sato, R., Lachemi, M.; and Li, V. C., May-June 2010 Jan.-Feb. 2010... .... 65 Attenuation Aggregate gradation Effect of Aamaaue Size and Gradation on Salons —Characterization of Deep Surface-Opening Cracks in Concrete: Feasibility Concrete Mixtures (107-M71) Neptune, A. I., and Putman, B. J., Nov.-Dec. of Impact-Generated Rayleigh-Waves (107-M36) Chai, H. K.; Momoki, S.; 2010 , ie 625 Aggelis, D. G.; and Shiotani, T., May-June 2010 Air entrainment Effects of Hauling Time on Air-Entrained Self- —Wavelet Analysis of Ultrasonic Pulses in Cement-Based Materials (107-M29) Consolidating Concrete (107-M32) Ghafoori, N., and Barfield, M., PUREE TE, Bac IE NO cis cec ciaae daacarrkanyececni s 248 May-June 2010 . eisisats dp Ney Autoclave Effect of Aggregate Type on Mechanical Properties of Reactive Air void Effects of Hauling Time o« n Air- Entrained Self-Consolidating Powder Concrete (107-M50) Aydin, S.; Yazici, H.; Yardimci, M. Y.; and Concrete (107-M32) Ghafoori, N., and Barfield, M., May-June 2010 . . . 275 Yigiter, H., Sept.-Oct. 2010 Akalin, O. Self-Consolidating High-Strength Concrete Optimization by Autogenous shrinkage Shrinkage of Precast, Prestressed Self-Consolidating Mixture Design Method (107-M41) July-Aug. 2010 Concrete (107-M27) Khayat, K. H., and Long, W. J., May-June Akay, K. U. Self-Consolidating High-Strength Concrete Optimization by Mixture Design Method (107-M41) July-Aug. 2010... . ee Aydin, S. Effect of Aggregate Type on Mechanical Properties of Reactive Alaejos, P. Models for Chloride Diffusion Coefficients of Concretes in Powder Concrete (107-M50) Sept.-Oct. 2010 .. Tidal Zone (107-M01) Jan.-Feb. 2010 i onan Alexander, M. G. Suitability of Various Measurement Techniques for Assessing Corrosion in Cracked Concrete (107-M55) Sept.-Oct. 2010. ts a . 481 Baeza, F. J. Triple Percolation in Concrete Reinforced with Carbon Fiber Al Jadiri, R. s. New Method for Pespertening Self-C onsolidating I aa TD, ....w oss sunita ceusenssvdibuoscesss 396 Concrete Based on Compressive Strength Requirements (107-M56) Barfield, M. Effects of Hauling Time on Air-Entrained Self-Consolidating Sept.-Oct. 2010 490 Concrete (107-M32) May-June 2010 .....22..... e.e ee. ee.e e ee 275 Alkali-aggregate reaction Reventigntion of Alkali-S ilica Reaction Inhibited Basu, P. C. by New Lithium Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; —New Methodology to Proportion Self-Consolidating Concrete with High- Tang, M.; Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010 .......... 37 Volume Fly Ash (107-M26) May-June 2010 2s 648 ACI Materials Journal/March-April 2011 —Strength-Cementitious Material-Water Relationship for Proportioning of Fly Ash-Based Concrete (107-M39) July-Aug. 2010 C Belaid, K. Performance of Cast-in-Place Self-Consolidating Concrete Made with Various Types of Viscosity-Enhancing Admixtures (107-M47) Calcium chloride Effect of Calcium Chloride and Initial Curing Temperature July-Aug. 2010 on Expansion Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and Bennacer, R. Analysis of Mortar Long-Term Strength with Supplementary Kurtis, K. E., Nov.-Dec. 2010 Cementitious Materials Cured at Different Temperatures (107-M37) July-Aug. Calcium hydroxide content Calcium Hydroxide Formation in Thin Cement ME stot ola nae nana eee Ned oO Mek Wie ease ee de wage Ree 323 Paste Exposed to Air (107-M42) Haselbach, L. M., and Liu, L., July-Aug. Bentz, D. P. —Planar Image-Based Reconstruction of Pervious Concrete Pore Structure Calcium Hydroxide Formation in Thin Cement Paste Exposed to Air and Permeability Prediction (107-M48) July-Aug. 2010 (107-M42) Haselbach, L. M., and Liu, L., July-Aug. 2010 —Powder Additions to Mitigate Retardation in High-Volume Fly Ash Carbon Carbon-Fiber Cement-Based Materials for Electromagnetic Mixtures (107-M58) Sept.-Oct. 2010 Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec. Bermudez, M. A. Models for Chloride Diffusion Coefficients of Concretes in Tidal Zone (107-MO1) Jan.-Feb. 2010 ...................00000- 3 Carbon fiber Triple Percolation in Concrete Reinforced with Carbon Fiber Bernard, E. S. Influence of Fiber Type on Creep Deformation of Cracked (107-M46) Baeza, F. J.; Chung, D. D. L.; Zornoza, E.; Andién, L. G.; and Fiber-Reinforced Shotcrete Panels (107-M54) Sept.-Oct. 2010 Garcés, P., July-Aug. 2010 Beushausen, H. D. Suitability of Various Measurement Techniques for Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding Assessing Corrosion in Cracked Concrete (107-M55) Sept.-Oct. (107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec. 2010... 602 Carse, A. H. Performance of Permeability-Reducing Admixtures in Marine Bhattacharjee, B. Effect of Age and Water-Cement Ratio on Size and Concrete Structures (107-M34) May-June 2010 Dispersion of Pores in Ordinary Portland Cement Paste (107-M19) Mar.-Apr. Cathodic protection Conductive Concrete for Cathodic Protection of Bridge Decks (107-M65) Yehia, S., and Host, J., Nov.-Dec. 2010 . . . 577 Bhethanabotla, V. R. Measurement of Oxygen Permeability of Epoxy Cation exchange capacity Detection of Aggregate Clay Coatings and Polymers (107-M18) Mar.-Apr. 2010 Impacts on Concrete (107-M45) Mufioz, J. F.; Tejedor, M. I.; Anderson, M. A.; Bidirectional Multiple Cracking Tests on High-Performance Fiber- ond Conmmas, 3. BE, PRG, FOOD vas cee ivcnwscademiiennnaa ’ 387 Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.; Cement asphalt mortar Temperature Stability of Compressive Strength of Nagai, K.; and Maekawa, K., Sept.-Oct. 2010 Cement Asphalt Mortar (107-M04) Wang, F.; Liu, Z.; Wang, T.; and Hu, S., Bilir, T. Jan.-Feb. 2010 —Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of Cement-based materials Wavelet Analysis of Ultrasonic Pulses in Mortars (107-M08) Jan.-Feb. 2010 Cement-Based Materials (107-M29) Nogueira, C. L., May-June 2010... 248 —Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate on Shrinkage Cracking of Mortars (107-M61) Nov.-Dec. Cement paste SR cst 675s 6 sa Minna a pli a wie eR aa naw nw a aloa gk a Oe —Effect of Age and Water-Cement Ratio on Size and Dispersion of Pores Blunt, J. Electrical Resistance Tomography for Assessment of Cracks in in Ordinary Portland Cement Paste (107-M19) Kondraivendhan, B., and Concrete (107-M60) Sept.-Oct. 2010 Bhattacharjee, B., Mar.-Apr. 2010 Bonakdar, A. Correlation of Reaction Products and Expansion Potential in —Investigation into Yield Behavior of Fresh Cement Paste: Model and Alkali-Silica Reaction for Blended Cement Materials (107-M44) July-Aug. Experiment (107-M02) Lu, G., and Wang, K., Jan.-Feb. 2010 ME ane tc £05k SARL ATIC a LEGER Ges CUS a wee Ren te eRe RAG 380 Cetrangolo, G. P. Inspection of Concrete Using Air-Coupled Ultrasonic Bond Pulse Velocity (107-M20) Mar.-Apr. 2010 —Comparison of Methods for Texture Assessment of Concrete Surfaces Chai, H. K. Characterization of Deep Surface-Opening Cracks in (107-M49) Santos, P. M. D., and Santos Julio, E. N. B., Sept.-Oct. Concrete: Feasibility of Impact-Generated Rayleigh-Waves (107-M36) RnPee,s Pee ee E e —Effect of Filtering on Texture Assessment of Concrete Surfaces (107-M05) Chandra, L. R. Early-Age Shrinkage Strains Versus Depth of Low Water- Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb. 2010 ..... 31 Cement Ratio Mortar Prisms (107-M25) May-June 2010 Bond strength Characterization of Deep Surface-Opening Cracks in Concrete: Feasibility —Interface Tailoring of Polyester-Type Fiber in Engineered Cementitious of Impact-Generated Rayleigh-Waves (107-M36) Chai, H. K.; Composite Matrix against Pullout (107-M15) Rathod, J. D., and Patodi, S. C., Momoki, S.; Aggelis, D. G.; and Shiotani, T., May-June 2010 .... 305 Mar.-Apr. 2010 Chemical composition Correlation of Reaction Products and Expansion —Polyvinyl Alcohol Fiber-Reinforced Mortars for Masonry Applications Potential in Alkali-Silica Reaction for Blended Cement Materials (107-M09) Skourup, B. N., and Erdogmus, E., Jan.-Feb. 2010....... 57 (107-M44) Bonakdar, A.; Mobasher, B.; Dey, S. K.; and Roy, D. M., Bottom ash Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking July-Aug. 2010 of Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010 Chloride Influence of Chemistry of Chloride Ions in Cement Matrix on Bougara, A. Analysis of Mortar Long-Term Strength with Supplementary Corrosion of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.; Kim, S.-H.; Cementitious Materials Cured at Different Temperatures (107-M37) and Rah, G:F, HR Ss ais oie dk cant icceas oy ieenee eee July-Aug. 2010 Chloride attack Corrosion Process of Steel Bar in Concrete in Full Lifetime Bridging oxygens Correlation of Reaction Products and Expansion (107-M63) Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec. 2010 Potential in Alkali-Silica Reaction for Blended Cement Materials Chloride-induced corrosion (107-M44) Bonakdar, A.; Mobasher, B.; Dey, S. K.; and Roy, D. M., —Performance of Permeability-Reducing Admixtures in Marine Concrete yc akbie re Sede kabigvhsdiscsacntuagn sinsne ’ 380 Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Morris, P. H.; and Carse, A. H.., Brooks, Z. Instantaneous In-Situ Determination of Water-Cement Ratio of May-June 2010 Fresh Concrete (107-M66) Nov.-Dec. 2010 —Suitability of Various Measurement Techniques for Assessing Corrosion Brucite Expansion of MgO in Cement Pastes Measured by Different in Cracked Concrete (107-M55) Otieno, M. B.; Alexander, M. G.; and Methods (107-M12) Nokken, M. R., Jan.-Feb. 2010 Beushausen, H. D., Sept.-Oct. 2010 Buffering Influence of Chemistry of Chloride Ions in Cement Matrix on Chloride ingress Corrosion of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.,; —Models for Chloride Diffusion Coefficients of Concretes in Tidal Zone Kim, S.-H.; and Ann, K. Y., July-Aug. 2010.................... 332 (107-M01) Bermidez, M. A., and Alaejos, P., Jan.-Feb. 2010 Building technology Powder Additions to Mitigate Retardation in —Time Evolution of Chloride Penetration in Blended Cement Concrete High-Volume Fly Ash Mixtures (107-M58) Bentz, D. P., Sept.-Oct. (107-M67) Villagran-Zaccardi, Y. A.; Taus, V. L.; and Di Maio, A. A., ACI Materials Journal/March-April 2011 Choi, S. C. Conductive concrete Conductive Concrete for Cathodic Protection of —New Viscoelastic Model for Early-Age Concrete Based on Measured Bridge Decks (107-M65) Yehia, S., and Host, J., Nov.-Dec. 2010 . . . 577 Strains and Stresses (107-M28) May-June 2010. . Conductive Concrete for Cathodic Protection of Bridge Decks (107-M65) —Thermal Strain and Drying Shrinkage of Concrete Structures in the Field Wee, B.S ee, BSE. BOO sos 5 cic ws csc bcerinssns 577 (107-M57) Sept.-Oct. 2010 ay 7 (sivandeedew esi Correlation of Reaction Products and Expansion Potential in Chowdhury, S. Alkali-Silica Reaction for Blended Cement Materials (107-M44) —Measurement of Oxygen Permeability of Epoxy Polymers (107-M18) Bonakdar, A.; Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug. Mar.-Apr. 2010 . A, ErEee eet Pee TTT ee er eee Perey —New Methodology to Proportion Self Co nsolidating Co ncrete with High- Corrosion Volume Fly Ash (107-M26) May-June 2010 o« Oae —Conductive Concrete for Cathodic Protection of Bridge Decks (107-M65) —Strength-Cementitious Material-Water Relationship for Proportioning Yehia, S., and Host, J., Nov.-Dec. 2010 of Fly Ash-Based Concrete (107-M39) July-Aug. 2010 i 340 —Corrosion Protection of Fiber-Reinforced Polymer-Wrapped Reinforced Chung, D. D. L. Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S. N., —Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding July-Aug. 2010 nina oun aaiadhaayt eeeee hminia nieee (107-M68) Nov.-Dec. 2010 : ; — 602 —AInfluence of Chemistry of Chloride Ions in Cement Matrix on Corrosion —Triple Percolation in Concrete Reinforced with C asbon Fiber (107-M46) of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.; Kim, S.-H.; and July-Aug. 2010 ...... 396 Ann, K. Y., July-Aug. 2010 . Chung, W. Y.-M. Cosep Behavior of High- Strength ‘Conceste with —Measurement of Oxygen Permeability of Epoxy Polymers (107-M18) Polypropylene Fibers at Elevated Temperatures (107-M22) Mar.-Apr. Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr. 2010 wa 176 2010 Clays Detection of Aggnese Clay Coatings and ‘Impects on Concrete —Modeling Mechanical Behavi ior of Reinforced Concrete due to Corrosion (107-M45) Muifioz, J. F.; Tejedor, M. 1.; Anderson, M. A.; and Cramer, S. M., of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.; and Oh, B. H.., July-Aug. 2010. ata . 387 Mar.-Apr. 2010 Coarse aggregate Detection of Aggvegnte Clay C eatings and leapacts on Corrosion assessment Suitability of Various Measurement Techniques for Concrete (107-M45) Mufioz, J. F.; Tejedor, M. L.; Anderson, M. A.; and Assessing Corrosion in Cracked Concrete (107-M55) Otieno, M. B.; Cramer, S. M., July-Aug. 2010... . .. 387 Alexander, M. G.; and Beushausen, H. D., Sept.-Oct. 2010 Coastal environment Performance of Permeability- Reducing Adenine Corrosion Process of Steel Bar in Concrete in Full Lifetime (107-M63) in Marine Concrete Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec. 2010................ 562 Morris, P. H.; and Carse, A. H., May-June 2010 ... cnn cawwee Corrosion Protection of Fiber-Reinforced Polymer-Wrapped Reinforced Coatings Detection of Aggregate Clay Coatings and Impacts on Concrete Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S. N., (107-M45) Mufioz, J. F.; Tejedor, M. L.; Anderson, M. A.; and Cramer, S. M., July-Aug. 2010 July-Aug. 2010 . 387 Corrosion rate Corrosion Process of Steel Bar in Concrete in Full Compacted Sand Concrete in Pavement co nstruction: An Econeusiea! Lifetime (107-M63) Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec. and Environmental Solution (107-M24) El Euch Khay, S.; Neji, J.; and 2010 Loulizi, A., Mar.-Apr. 2010 ae wwe se tas Crack detection Electrical Resistance Tomography for Assessment of Comparison of Methods for Texture Aaneenmnent of reo ncrete Surfaces Cracks in Concrete (107-M60) Karhunen, K.; Seppianen, A.; Lehikoinen, A.; (107-M49) Santos, P. M. D., and Santos Julio, E. N. B., Sept.-Oct. Blunt, J.; Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. 2010 ... . . 523 2010 —— 433 Cracked concrete Suitability of Various Measurement Techniques for Compliance function New Viecosiantic Model for Early-Age Concrete Assessing Corrosion in Cracked Concrete (107-M55) Otieno, M. B.; Basedo n Measured Strains and Stresses (107-M28) Choi, S. C., and Oh, B. H., Alexander, M. G.; and Beushausen, H. D., Sept.-Oct. 2010 May-June 2010 ; ; "Ce aa Cracking Compressive strength —Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of —Analysis of Mortar Long-Term Strength with Supplementary Cementitious Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010 Materials Cured at Different Temperatures (107-M37) Ezziane, K.; —Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug. 2010 .. 323 on Shrinkage Cracking of Mortars (107-M61) Topgu, I. B., and Bilir, T., —dAssessing Mechanical Properties and Microstructure of Fire-Damaged Nov.-Dec. 2010. ee ee ee Engineered Cementitious Composites (107-M35) Sahmaran, M.; Lachemi, M.; —Modeling Mechondenl Behavior of Reinforced Concrete due to Corrosion and Li, V.C., May-June 2010........ , . 297 of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.; and Oh, B. H., —Compacted Sand Concrete in Pavement Constenation: An Economical Mar.-Apr. 2010 . and Environmental Solution (107-M24) El Euch Khay, S.; Neji, J.; and Cramer, S. M. Detection of Aggregate Clay Coatings and Impacts on Loulizi, A., Mar.-Apr. 2010 ..... = is 195 Concrete (107-M45) July-Aug. 2010 ................-..+.4++.3.8 7 —Compressive Strength Relationships for Concrete under Elevated Creep Temperatures (107-M21) Knaack, A. M.; Kurama, Y. C.; and Kirkner, D. J., —Creep Behavior of High-Strength Concrete with Polypropylene Fibers at Mar.-Apr. 2010... . Serer Elevated Temperatures (107-M22) Wu, B.; Lam, E. S.-S.; Liu, Q.; —Polyviny! Alcohol Fiber- Reinfoaced Mortars for Mesenty Applications Chung, W. Y.-M.; and Ho, I. F.-Y., Mar.-Apr. 2010 (107-M09) Skourup, B. N., and Erdogmus, E., Jan.-Feb. 2010 —Influence of Fiber Type on Creep Deformation of Cracked Fiber-Reinforced —Precision of Compressive Strength Testing of Concrete with Different Shotcrete Panels (107-M54) Bernard, E. S., Sept.-Oct. 2010 Cylinder Specimen Sizes (107-M52) Taghaddos, H.; Soleymani, H. R.; Creep Behavior of High-Strength Concrete with Polypropylene Fibers and Robson, J. D., Sept.-Oct. 2010 — at Elevated Temperatures (107-M22) Wu, B.; Lam, E. S.-S.; Liu, Q.; —Size and Wall Effects on Compressive Strength of Concretes (107-M43) Chung, W. Y.-M.; and Ho, I. F.-Y., Mar.-Apr. 2010 . 176 Turkel, A., and Ozkul, M. H., July-Aug. 2010 : 372 Critical Corrosion Threshold of Galvanized Reinforcing Bars (106-M22) —Temperature Stability of Compressive Strength of Cement t Asphalt Mortar —Darwin, D.; Browning, J.; O'Reilly, M.; Xing, L.; and Ji, J., Mar.-Apr. (107-M04) Wang, F.; Liu, Z.; Wang, T.; and Hu, S., Jan.-Feb. 2010 27 Compressive Strength Relationships for Concrete under Elevated Temperatures (107-M21) Knaack, A. M.; Kurama, Y. C.; and Kirkner, D. J., Crystalline swelling Detection of Aggregate Clay Coatings and Impacts on Mar.-Apr. 2010 : “es Terre re. Concrete (107-M45) Mufioz, J. F.; Tejedor, M. 1; Anderson, M. A.; and Concrete cores Size and Wall Effects on Compressive Strength of eg eeee ee e Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. 2010 . . .3 72 Curing Concrete mixture proportioning Self-Consolidating High-Strength —Effect of Calcium Chloride and Initial Curing Temperature on Expansion Concrete Optimization by Mixture Design Method (107-M41) Akalin, O.; Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and Kurtis, K. E., Akay, K. U.; and Sennaroglu, B., July-Aug. 2010 ................ 357 Nov.-Dec. 2010 650 ACI Materials Journal/March-April 2011 —Effect of Curing Methods on Autogenous Shrinkage and Self-Induced —Modeling Mechanical Behavior of Reinforced Concrete due to Corrosion Stress of High-Performance Concrete (107-M10) Meddah, M. S., and Sato, R., of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.; and Oh, B. H., Jan.-Feb. 2010 Mar.-Apr. 2010 Cutting damage Size and Wall Effects on Compressive Strength of —Models for Chloride Diffusion Coefficients of Concretes in Tidal Zone Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. 2010... 372 (107-MO1) Bermiidez, M. A., and Alaejos, P., Jan.-Feb. 2010 ........ 3 Cylinders Precision of Compressive Strength Testing of Concrete with Different —Performance of Permeability-Reducing Admixtures in Marine Concrete Cylinder Specimen Sizes (107-M52) Taghaddos, H.; Soleymani, H. R.; Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Morris, P. H.; and and Robson, J. D., Sept.-Oct. 2010 Carse, A. H., May-June 2010 —Salt Weathering of Concrete by Sodium Carbonate and Sodium Chloride (107-M30) Haynes, H.; O’ Neill, R.; Neff, M.; and Mehta, P. K., May-June Damage assessment Numerical Simulation of Stress Waves on Surface of Dux, P. F. Performance of Permeability-Reducing Admixtures in Marine Strongly Heterogeneous Media (107-M53) Aggelis, D. G., Sept.-Oct. Concrete Structures (107-M34) May-June 2010 Dao, V. T. N. Performance of Permeability-Reducing Admixtures in Marine Concrete Structures (107-M34) May-June 2010 ........... 291 Deng, M. Eamon, C. D. Ultra-High-Strength, Glass Fiber-Reinforced Concrete: —lInvestigation of Alkali-Silica Reaction Inhibited by New Lithium Mechanical Behavior and Numerical Modeling (107-M23) Mar.-Apr. Compound (107-M06) Jan.-Feb. 2010... 2.2.200...0. e.e.e e.a e 37 2010 —Potential Approach to Evaluating Soundness of Concrete Containing Early age Early-Age Shrinkage Strains Versus Depth of Low Water- MgO-Based Expansive Agent (107-M13) Mar.-Apr. 2010 Cement Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.; Design and Myint-Lay, K., May-June 2010.....................2+.--- 213 —Compressive Strength Relationships for Concrete under Elevated Early-age autogenous shrinkage Effect of Curing Methods on Autogenous Temperatures (107-M21) Knaack, A. M.; Kurama, Y. C.; and Kirkner, D. J., Shrinkage and Self-Induced Stress of High-Performance Concrete Mar.-Apr. 2010 (107-M10) Meddah, M. S., and Sato, R., Jan.-Feb. 2010 —Design and Research on Gradient Structure Concrete Based on Volumetric Early-age concrete Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; Gan, W.-Z.; and Xian, Z.-W.., —Artificial Neural Network Modeling of Early-Age Dynamic Young's Nov.-Dec. 2010 Modulus of Normal Concrete (107-M33) Venkiteela, G.; Gregori, A.; Sun, Z.; Design and Research on Gradient Structure Concrete Based on Volumetric and Shah, S. P., May-June 2010 282 Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; Gan, W.-Z.; and —New Viscoelastic Model for Early-Age Concrete Based on Measured Strains Xian, Z.-W., Nov.-Dec. 2010 and Stresses (107-M28) Choi, S. C., and Oh, B. H., May-June 2010.... . 239 Detection ofA ggregate Clay Coatings and Impacts on Concrete (107-M45) Early-Age Shrinkage Strains Versus Depth of Low Water-Cement Muniz, J. F.; Tejedor, M. I.; Anderson, M. A.; and Cramer, S. M., July-Aug. Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.; and Myint-Lay, K., May-June 2010 Deterioration Salt Weathering of Concrete by Sodium Carbonate and Effect of Age and Water-Cement Ratio on Size and Dispersion of Pores Sodium Chloride (107-M30) Haynes, H.; O'Neill, R.; Neff, M.; and in Ordinary Portland Cement Paste (107-M19) Kondraivendhan, B., Mehta, P. K., May-June 2010 and Bhattacharjee, B., Mar.-Apr. 2010 Mee) Dey, S. K. Correlation of Reaction Products and Expansion Potential in Effect of Aggregate Size and Gradation on Pervious Concrete Mixtures Alkali-Silica Reaction for Blended Cement Materials (107-M44) July-Aug. (107-M71) Neptune, A. L., and Putman, B. J., Nov.-Dec. 2010 Effect of Aggregate Type on Mechanical Properties of Reactive Powder Diffusion Measurement of Oxygen Permeability of Epoxy Polymers Concrete (107-MS50) Aydin, S.; Yazici, H.; Yardimci, M. Y.; and Yigiter, H., (107-M18) Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Sept.-Oct. 2010 Mar.-Apr. 2010 Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of Di Maio, A. A. Time Evolution of Chloride Penetration in Blended Cement Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010 Concrete (107-M67) Nov.-Dec. 2010 Effect of Calcium Chloride and Initial Curing Temperature on Expansion Direct tension test Ultra-High-Strength, Glass Fiber-Reinforced Concrete: Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and Kurtis, K. E., Mechanical Behavior and Numerical Modeling (107-M23) Roth, M. J.; Nov.-Dec. 2010 Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A., Mar.-Apr. Effect of Curing Methods on Autogenous Shrinkage and Self-Induced Stress of High-Performance Concrete (107-M10) Meddah, M. S., and Dispersion Effect of Age and Water-Cement Ratio on Size and Dispersion Sato, R., Jan.-Feb. 2010 of Pores in Ordinary Portland Cement Paste (107-M19) Kondraivendhan, B.., Effect of Different Dosages of Polypropylene Fibers in Thin Whitetopping and Bhattacharjee, B., Mar.-Apr. 2010 Concrete Pavements (107-M07) Rodezno, M. C., and Kaloush, K. E., Drilling damage Size and Wall Effects on Compressive Strength of Jan.-Feb. 2010 Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. 2010... 372 Effect of Filtering on Texture Assessment of Concrete Surfaces (107-M05) Drying shrinkage Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb. 2010 ..... 31 —Shrinkage of Precast, Prestressed Self-Consolidating Concrete (107-M27) Effect of Mixture Compositions on Workability and Strength of Fly Khayat, K. H., and Long, W. J., May-June 2010 Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., and Sun, P., —Thermal Strain and Drying Shrinkage of Concrete Structures in the Field Nov.-Dec. 2010 (107-M57) Choi, S., and Won, M. C., Sept.-Oct. 2010 Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate Duarte Santos, P. M. Effect of Filtering on Texture Assessment of on Shrinkage Cracking of Mortars (107-M61) Topcu, I. B., and Bilir, T., Concrete Surfaces (107-M05) Jan.-Feb. 2010 ... 2... ......0.00055 31 Nov.-Dec. 2010 Dubey, A. Ultra-High-Strength, Glass Fiber-Reinforced Concrete: Effects of Hauling Time on Air-Entrained Self-Consolidating Concrete Mechanical Behavior and Numerical Modeling (107-M23) Mar.-Apr. (107-M32) Ghafoori, N., and Barfield, M., May-June 2010 2010 re 185 Effeocf tLiqsui d Nitrogen Cooling on Fresh Concrete Properties (107-M16) Ductility Experimental Study on Mechanical Properties of Concrete Juenger, M. C. G.; Solt, S. M.; and Hema, J., Mar.-Apr. 2010 123 Confined with Plastic Pipe (107-M17) Wang, J., and Yang, Q., Mar.-Apr. Efficiency factors Models for Chloride Diffusion Coefficients of Concretes 2010 in Tidal Zone (107-M01) Bermiidez, M. A., and Alaejos, P., Jan.-Feb. Durability BD ciicncdine® ixdieckbek supe dns heen aednee ae 3 —Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh Electrical conductivity Triple Percolation in Concrete Reinforced with Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.; Carbon Fiber (107-M46) Baeza, F. J.; Chung, D. D. L.; Zornoza, E.; me Genet, B. 0, ROO IOR FIs oc ick bins sv edveciavendands 586 Andion, L. G.; and Garcés, P., July-Aug. 2010 ACI Materials Journal/March-April 2011 Electrical resistance tomography Electrical Resistance Tomography for Fiber-reinforced mortar Polyviny! Alcohol Fiber-Reinforced Mortars for Assessment of Cracks in Concrete (107-M60) Karhunen, K.; Seppanen, A.; Masonry Applications (107-M09) Skourup, B. N., and Erdogmus, E., Lehikoinen, A.; Blunt, J.; Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. Re Pe ory ee ee ne Pee ete re Eee 57 2010. Fiber-reinforced polymer Electrical Resistance Tomography for Assessment of Cracks in —Corrosion Protection of Fiber-Reinforced Polymer-Wrapped Reinforced Concrete (107-M60) Karhunen, K.; Seppiinen, A.; Lehikoinen, A.; Blunt, J.; Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S..N., Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. 2010 ............. 523 I DUE ia tb es Uhl ce <sn ca canoer Seeimksicek nema ee 349 Electrical resistivity —Environmental Effects on Mechanical Properties of Wet Lay-Up Fiber- —Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding Reinforced Polymer (107-M31) Saadatmanesh, H.; Tavakkolizadeh, M.; (107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec. 2010 . . . 602 and Mostofinejad, D., May-June 2010 ...............--2.0eeeee 267 —Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh Field implementation Thermal Strain and Drying Shrinkage of Concrete Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.; Structures in the Field (107-M57) Choi, S., and Won, M. C., Sept.-Oct. and Glaser, S. D., Nov.-Dec. 2010 .. 586 —Triple Percolation in Concrete Reinforced with cw hen Fiber (107-M46) Filter Effect of Filtering on Texture Assessment of Concrete Surfaces Baeza, F. J.; Chung, D. D. L.; Zornoza, E.; Andién, L. G.; and Garcés, P., (107-M05) Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb. July-Aug. 2010. Sees Electromagnetic shielding Carbon-Fiber Comes Based Materials for Electromagnetic Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., —Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of Nov.-Dec. 2010... .. . 602 Mortars (107-M08) Topcu, I. B., and Bilir, T., Jan.-Feb. 2010 El Euch Khay, S. Compacted Sand Conceete ii n Povement Construction: An —Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate Economical and Environmental Solution (107-M24) Mar.-Apr. 2010 . . . 195 on Shrinkage Cracking of Mortars (107-M61) Topgu, I. B., and Bilir, T., El-Tawil, S. Hybrid Rotating/Fixed-Crack Model for High-Performance Fiber- UII SII Bao oa birds Gis eux oo amare dt nok eee ala ta 545 Reinforced Cementitious Composites (107-M64) Nov.-Dec. 2010 .... . . 568 Finite element analysis Ultra-High-Strength, Glass Fiber-Reinforced Energy absorption Polyvinyl Alcohol Fiber-Reinforced Mortars for Concrete: Mechanical Behavior and Numerical Modeling (107-M23) Masonry Applications (107-M09) Skourup, B. N., and Erdogmus, E., Roth, M. J.; Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A Jan.-Feb. 2010 ss ee Mar.-Apr. 2010 Engineered cementitious composites Fire resistance Assessing Mechanical Properties and Microstructure of —Assessing Mechanical Properties and Microstructure of Fire-Damaged Fire-Damaged Engineered Cementitious Composites (107-M35) Engineered Cementitious Composites (107-M35) Sahmaran, M.; Lachemi, M.; Sahmaran, M.; Lachemi, M.; and Li, V. C., May-June 2010 ........ 297 and Li, V. C., May-June 2010 . 297 Fixed-crack approach Hybrid Rotating/Fixed-Crack Model for High- —Self-Healing Characterization of Bagineesed Cementitious Composite Performance Fiber-Reinforced Cementitious Composites (107-M64) Materials (107-M70) Kan, L.-L.; Shi, H.-S.; Sakulich, A. R.; and Li, V. C., Hung, C.-C., and El-Tawil, S., Nov.-Dec. 2010 Nov.-Dec. 2010 eye Flexural strength Compacted Sand Concrete in Pavement Construction: Environmental effects Environmental Effects on Mec henical Peapestion of An Economical and Environmental Solution (107-M24) El Euch Khay, S.; Wet Lay-Up Fiber-Reinforced Polymer (107-M31) Saadatmanesh, H.; Neji, J.; and Loulizi, A., Mar.-Apr. 2010 Tavakkolizadeh, M.; and Mostofinejad, D., May-June 2010 ........ 267 Flexural test Ultra-High-Strength, Glass Fiber-Reinforced Concrete: Environmental Effects on Mechanical Properties of Wet Lay-Up Fiber- Mechanical Behavior and Numerical Modeling (107-M23) Roth, M. J.; Reinforced Polymer (107-M31) Saadatmanesh, H.; Tavakkolizadeh, M.; Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A., Mar.-Apr. and Mostofinejad, D., May-June 2010. 2010 Epoxy Measurement of Oxygen Permeability of Epoxy Poly:m ers (107-M18) Flexure Polyvinyl Alcohol Fiber-Reinforced Mortars for Masonry Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr Applications (107-M09) Skourup, B. N., and Erdogmus, E., Jan.-Feb. 2010 i ee 2010. Erdogmus, E. Polyviny! Alcohol Fiber- Reinforced Mortars for Masonry Flexure strength Corrosion Protection of Fiber-Reinforced Polymer- Applications (107-M09) Jan.-Feb. 2010... <aveca Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Expansion of MgO in Cement Pastes Measured by Different Methods Pe: i ee NE: SOs oso sva cdcckwssacemaatdanenee 349 (107-M12) Fly ash —Nokken, M. R., Jan.-Feb. 2010 : Parmnine acto aaae —Correlation of Reaction Products and Expansion Potential in Alkali- —Disc. by Wang, H., and Qi, C., Nov.-Dec. 2010. . . iia 640 Silica Reaction for Blended Cement Materials (107-M44) Bonakdar, A.; Expansion pressure Modeling Mechanical Behavior of Reinfesc ed Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug. 2010 ........ 380 Concrete due to Corrosion of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; —Effect of Mixture Compositions on Workability and Strength of Fly Ash- Jang, B. S.; and Oh, B. H., Mar.-Apr. 2010 eee . 106 Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., and Sun, P., Experimental Study on Mechanical Properties of Concrete Confined with Nov.-Dec. 2010 PlasPitpei (c10 7-M17) WangJ.,, a nd Yang, Q., Mar.-Apr. 2010... .... 132 —Synergistic Effect between Glass Frit and Blast-Furnace Slag (107-M11) Ezziane, K. Analysis of Mortar Long-Term Strength with Supplementary Laldji, S.; Phithaksounthone, A.; and Tagnit-Hamou, A., Jan.-Feb. Cementitious Materials Cured at Different Temperatures (107-M37) 2010 July-Aug. 2010 ... ne ae en 323 Fly ash-based concrete Strength-Cementitious Material-Water Relationship for Proportioning of Fly Ash-Based Concrete (107-M39) Chowdhury, S., F and Basu, P. C., July-Aug. 2010 Formwork pressure Intrinsic Model to Predict Formwork Pressure Fabric Environmental Effects on Mechanical Properties of Wet Lay-Up (107-M03) Kwon, S. H.; Shah, S. P.; Phung, Q. T.; Kim, J. H.; and Lee, Y., Fiber-Reinforced Polymer (107-M31) Saadatmanesh, H.; Tavakkolizadeh, M.; Jan.-Feb. 2010 and Mostofinejad, D., May-June 2010 . Fournier, B. Investigation of Alkali-Silica Reaction Inhibited by New Fatigue Compacted Sand Concrete in Pavement Construction: ae Economical Lithium Compound (107-M06) Jan.-Feb. 2010 ...................37 and Environmental Solution (107-M24) El Euch Khay, S.; Neji, J.; and Fracture energy Effect of Aggregate Type on Mechanical Properties of Loulizi, A., Mar.-Apr. 2010. aera: Reactive Powder Concrete (107-MS50) Aydin, S.; Yazici, H.; Yardimci, M. Y.; Fiber Carbon-Fiber Coment- Based Materials fn Electromagnetic and Yigiter, H., Sept.-Oct. 2010 Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec. Frequency analysis Wavelet Analysis of Ultrasonic Pulses in Cement- a ne inoue wee Based Materials (107-M29) Nogueira, C. L., May-June 2010....... 248 Fiber-reinforced cc oncrete Influence of Fiber Type on Crre ep Deformation Fresh concrete Instantaneous In-Situ Determination of Water-Cement of Cracked Fiber-Reinforced Shotcrete Panels (107-M54) Bernard, E. S., Ratio of Fresh Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Sept.-Oct. 2010 Monteiro, P. J. M.; and Glaser, S. D., Nov.-Dec. 2010 ............. 586 652 ACI Materials Journal/March-April 2011 Ho, I. F.-Y. Creep Behavior of High-Strength Concrete with Polypropylene G Fibers at Elevated Temperatures (107-M22) Mar.-Apr. 2010 Host, J. Conductive Concrete for Cathodic Protection of Bridge Decks Gadve, S. Corrosion Protection of Fiber-Reinforced Polymer-Wrapped (107-M65) Nov.-Dec. 2010 Reinforced Concrete (107-M40) July-Aug. 2010................. 349 Hot weather concreting Effects of Liquid Nitrogen Cooling on Fresh Gan, W.-Z. Design and Research on Gradient Structure Concrete Based on Concrete Properties (107-M16) Juenger, M. C. G.; Solt, S. M.; and Hema, J., Volumetric Stabilization (107-M69) Nov.-Dec. 2010 Mar.-Apr. 2010 Garcés, P. Triple Percolation in Concrete Reinforced with Carbon Fiber Hu, S. Temperature Stability of Compressive Strength of Cement Asphalt ne isnie nthe curses teens Dhamma pees ate 396 Mortar (107-M04) Jan.-Feb. 2010 .. 2.2.0ce.e 2ce.ce. ee.e e es 27 Geopolymer Effect of Mixture Compositions on Workability and Strength Hung, C.-C. Hybrid Rotating/Fixed-Crack Model for High-Performance of Fly Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., and Fiber-Reinforced Cementitious Composites (107-M64) Nov.-Dec. Sun, P., Nov.-Dec. 2010 Ghafoori, N. Effects of Hauling Time on Air-Entrained Self-Consolidating Hiinger, K.-J. Investigation of Alkali-Silica Reaction Inhibited by New Concrete (107-M32) May-June 2010 Lithium Compound (107-M06) Jan.-Feb. 2010 Glaser, S. D. Instantaneous In-Situ Determination of Water-Cement Ratio Hwang, S.-D. Performance of Cast-in-Place Self-Consolidating Concrete of Fresh Concrete (107-M66) Nov.-Dec. 2010 Made with Various Types of Viscosity-Enhancing Admixtures (107-M47) Glass fiber-reinforced concrete Ultra-High-Strength, Glass Fiber-Reinforced July-Aug. 2010 Concrete: Mechanical Behavior and Numerical Modeling (107-M23) Hybrid Rotating/Fixed-Crack Model for High-Performance Fiber- Roth, M. J.; Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A., Reinforced Cementitious Composites (107-M64) Hung, C.-C., and Mar.-Apr. 2010 a ig SO, I SSW hs echGiics etree cansceginen 568 Glass frit Synergistic Effect between Glass Frit and Blast-Furnace Slag Hydration (107-M11) Laldji, S.; Phithaksounthone, A.; and Tagnit-Hamou, A., —Powder Additions to Mitigate Retardation in High-Volume Fly Ash Jan.-Feb. 2010 Mixtures (107-M58) Bentz, D. P., Sept.-Oct. 2010 ............... 508 Gradient Design and Research on Gradient Structure Concrete Based on —Strength-Cementitious Material-Water Relationship for Proportioning Volumetric Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; Gan, W.-Z.; of Fly Ash-Based Concrete (107-M39) Chowdhury, S., and Basu, P. C., and Xian, Z.-W., Nov.-Dec. 2010 July-Aug. 2010 Grain-size distribution Waveiet Analysis of Ultrasonic Pulses in Cement- Based Materials (107-M29) Nogueira, C. L., May-June 2010....... 248 Gregori, A. Artificial Neural Network Modeling of Early-Age Dynamic Young’s Modulus of Normal Concrete (107-M33) May-June 2010... . 282 Image analysis Early-Age Shrinkage Strains Versus Depth of Low Water- Ground-granulated blast-furnace slag Effect of Non-Ground-Granulated Cement Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.; Blast-Furnace Slag as Fine Aggregate on Shrinkage Cracking of Mortars and Myint-Lay, K., May-June 2010 (107-M61) Topgu, I. B., and Bilir, T., Nov.-Dec. 2010............ 545 Imaging —Electrical Resistance Tomography for Assessment of Cracks in Concrete H (107-M60) Karhunen, K.; Seppinen, A.; Lehikoinen, A.; Blunt, J.; Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. 2010 Hardened state properties New Methodology to Proportion Self- —Inspection of Concrete Using Air-Coupled Ultrasonic Pulse Velocity Consolidating Concrete with High-Volume Fly Ash (107-M26) Chowdhury, S., (107-M20) Cetrangolo, G. P., and Popovics, J. S., Mar.-Apr. 2010... . 155 and Basu, P. C., May-June 2010 Impressed current Conductive Concrete for Cathodic Protection of Bridge Haselbach, L. M. Calcium Hydroxide Formation in Thin Cement Paste Decks (107-M65) Yehia, S., and Host, J., Nov.-Dec. 2010 Exposed to Air (107-M42) July-Aug. 2010...................... 365 Inclined plane Inclined Plane Test to Evaluate Structural Buildup at Rest Hauling time Effects of Hauling Time on Air-Entrained Self-Consolidating of Self-Consolidating Concrete (107-M59) Khayat, K. H.; Omran, A. F.; Concrete (107-M32) Ghafoori, N., and Barfield, M., May-June 2010 . . . 275 onl Pavate, F. V., DURA. BIO 5 ov vicciicccavevecdexsaenvar 515 Haynes, H. Salt Weathering of Concrete by Sodium Carbonate and Sodium Inclined Plane Test to Evaluate Structural Buildup at Rest of Self- Chloride (107-M30) May-June 2010 Consolidating Concrete (107-M59) Khayat, K. H.; Omran, A. F.; and Hema, J. Effects of Liquid Nitrogen Cooling on Fresh Concrete Properties Pavate, T. V., Sept.-Oct. 2010 (107-M16) Mar.-Apr. 2010 Index Precision of Compressive Strength Testing of Concrete with Different High-density polyethylene pipe Experimental Study on Mechanical Cylinder Specimen Sizes (107-M52) Taghaddos, H.; Soleymani, H. R.; and Properties of Concrete Confined with Plastic Pipe (107-M17) Wang, J., Robson, J. D., Sept.-Oct. 2010 and Yang, Q., Mar.-Apr. 2010 Influence of Chemistry of Chloride Ions in Cement Matrix on Corrosion High-performance concrete Creep Behavior of High-Strength Concrete of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.; Kim, S.-H.; and with Polypropylene Fibers at Elevated Temperatures (107-M22) Wu, B.; Ann, K. Y., July-Aug. 2010 Lam, E. S.-S.; Liu, Q.; Chung, W. Y.-M.; and Ho, I. F.-Y., Mar.-Apr. Influence of Fiber Type on Creep Deformation of Cracked Fiber- Reinforced Shotcrete Panels (107-M54) Bernard, E. S., Sept.-Oct. High-performance fiber-reinforced cementitious composites Hybrid Rotating/Fixed-Crack Model for High-Performance Fiber-Reinforced Influence of Mixing Sequence on Cement-Admixture Interaction Cementitious Composites (107-M64) Hung, C.-C., and El-Tawil, S., (106-MS55) DM ME ces tccuhttack tek icede icadaaprnwhiamees nen 568 —Chen, C.-T., and Struble, L. J., Nov.-Dec. 2009 High-range water-reducing admixture Performance of Cast-in-Place —Disc. by Venkatachalapathy, V., Sept.-Oct. 2010 Self-Consolidating Concrete Made with Various Types of Viscosity- Initial damage Bidirectional Multiple Cracking Tests on High-Performance Enhancing Admixtures (107-M47) Khayat, K. H.; Hwang, S.-D.; and Fiber-Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.; Belaid, K., July-Aug. 2010 Nagai, K.; and Maekawa, K., Sept.-Oct. 2010 High-strength concrete Inorganic polymer Effect of Mixture Compositions on Workability and —Self-Consolidating High-Strength Concrete Optimization by Mixture Strength of Fly Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., Design Method (107-M41) Akalin, O.; Akay, K. U.; and Sennaroglu, B., and Sun, P., Nov.-Dec. 2010 July-Aug. 2010 Inspection of Concrete Using Air-Coupled Ultrasonic Pulse Velocity —Size and Wall Effects on Compressive Strength of Concretes (107-M43) (107-M20) Cetrangolo, G. P., and Popovics, J. S., Mar.-Apr. 2010 .... 155 Turkel, A., and Ozkul, M. H., July-Aug. 2010................... 372 Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh High-volume fly ash Powder Additions to Mitigate Retardation in High- Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.; Volume Fly Ash Mixtures (107-M58) Bentz, D. P., Sept.-Oct. 2010 . . . 508 and Glaser, S. D., Nov.-Dec. 2010 ACI Materials Journal/March-April 2011 653 Interface Kirkner, D. J. Compressive Strength Relationships for Concrete under —Comparison of Methods for Texture Assessment of Concrete Surfaces Elevated Temperatures (107-M21) Mar.-Apr. 2010 (107-M49) Santos, P. M. D., and Santos Julio, E. N. B., Sept.-Oct. Knaack, A. M. Compressive Strength Relationships for Concrete under Elevated Temperatures (107-M21) Mar.-Apr. 2010 —Effect of Filtering on Texture Assessment of Concrete Surfaces (107-M05) Kondraivendhan, B. Effect of Age and Water-Cement Ratio on Size and Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb. 2010...... 31 Dispersion of Pores in Ordinary Portland Cement Paste (107-M19) Interface Tailoring of Polyester-Type Fiber in Engineered Cementitious Mar.-Apr. 2010 CompoMastriix tagaeins t Pullout (107-M15) Rathod,J .D ., and Patodi, S. C., Kosbab, B. D. Effect of Calcium Chloride and Initial Curing Temperature Mar.-Apr. 2010 ane ee ee on Expansion Caused by Sulfate Exposure (107-M72) Nov.-Dec. Interfacial transition zone Corrosion Foscenn of Steel Bar in Concrete in Full Lifetime (107-M63) Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec. Kurama, Y. C. Compressive Strength Relationships for Concrete under 2010. ” Elevated Temperatures (107-M21) Mar.-Apr. 2010 Intrinsic model Intrinsic Model to Predict Penneed: Pressure (107- M03) Kurtis, K. E. Effect of Calcium Chloride and Initial Curing Temperature on Kwon, S. H.; Shah, S. P.; Phung, Q. T.; Kim, J. H.; and Lee, Y., Jan.-Feb. Expansion Caused by Sulfate Exposure (107-M72) Nov.-Dec. 2010 . . . 632 iA Ms BE es ah a ciara oS athe ig ee ae ald Sea 20 Kwon, S. H. Intrinsic Model to Predict Formwork Pressure (107-M03) Intrinsic Model to Predict Formwork Prenure ( 107-M 03) Kwon, S. H.; Jan.-Feb. 2010 Shah, S. P.; Phung, Q. T.; Kim, J. H.; and Lee, Y., Jan.-Feb. 2010... . 20 Investigation into Yield Behavior of Fresh Cement Paste: Model and L Experiment (107-M02) Lu, G., and Wang, K., Jan.-Feb. 2010....... 12 Investigation of Alkali-Silica Reaction Inhibited by New Lithium Lachemi, M. Assessing Mechanical Properties and Microstructure of Fire- Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; Tang, M.; Damaged Engineered Cementitious Composites (107-M35) May-June Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010......... 37 2010 Isothermal calorimetry Powder Additions to Mitigate Retandation ii n High- Laldji, S. Synergistic Effect between Glass Frit and Blast-Furnace Slag Volume Fly Ash Mixtures (107-M58) Bentz, D. P., Sept.-Oct. 2010... .5 08 (107-M11) Jan.-Feb. 2010 Lam, E. S.-S. Creep Behavioro f High-Strength Concrete with Poly peapylene J Fibers at Elevated Temperatures (107-M22) Mar.-Apr. 2010 Laser scanning Comparison of Methods for Texture Assessment of Jang, B. S. Modeling Mechanical Behavior of Reinforced Concrete due to Concrete Surfaces (107-M49) Santos, P. M. D., and Santos Julio, E. N. B., Corrosion of Steel Bar (107-M14) Mar.-Apr. 2010 ... 106 Sept.-Oct. 2010 Jang, S. Y. Modeling Mechanical Behavior of Reinforced Concrete due to Lee, C.-H. Influence of Chemistry of Chloride Ions in Cement Matrix on Corrosion of Steel Bar (107-M14) Mar.-Apr. 2010 .......... .. 106 Corrosion of Steel (107-M38) July-Aug. 2010 Jiang, J. Corrosion Process of Steel Bar in Concrete in Full Lifetime Lee, Y. Intrinsic Model to Predict Formwork Pressure (107-M03) Jan.-Feb. (107-M63) Nov.-Dec. 2010. . “ee . 562 2010 Juenger, M. C. G. Effects of Li quid Nitrogen Cooling on Fresh Concrete Lehikoinen, A. Electrical Resistance Tomography for Assessment of Properties (107-M16) Mar.-Apr. 2010 . . ee Cracks in Concrete (107-M60) Sept.-Oct. 2010. ................. Jung, M.-S. Influence of Chemistry of Chloride lons in Cement Matrix on Li, V. C. Corrosion of Steel (107-M38) July-Aug. 2010 , +s —Assessing Mechanical Properties and Microstructure of Fire-Damaged Engineered Cementitious Composites (107-M35) May-June 2010 . . . 297 K —Self-Healing Characterization of Engineered Cementitious Composite Materials (107-M70) Nov.-Dec. 2010 Kadri, E.-H. Analysis of Mortar Long-Term Strength with Supplementary Limestone Analysis of Mor ‘r Long-Term Strength with Supplementary Cementitious Materials Cured at Different Temperatures (107-M37) Cementitious Materials Cured at Different Temperatures (107-M37) July-Aug. 2010 ....... case 323 Ezziane, K.; Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug. Kaipio, J. P. Electrical Resistance Tomography for Asen ssment of Cracks 2010.... in Concrete (107-M60) Sept.-Oct. 2010 523 Limestone filler Time Evolution of Chloride Penetration in Blended Kaloush, K. E. Effect of Different Dosages of Polypropylene Fibers in Thin Cement Concrete (107-M67) Villagran-Zaccardi, Y. A.; Taus, V. L.; and Whitetopping Concrete Pavements (107-M07) Jan.-Feb. 2010 . 42 Di Maio, A. A., Nov.-Dec. 2010. 59: Kan, L.-L. Self-Healing Characterization of Engineered Cementitious Limewater Expansion of MgO in Cement Pastes Measured by Differeut Composite Materials (107-M70) Nov.-Dec. 2010 sera tals aa Methods (107-M12) Nokken, M. R., Jan.-Feb. 2010 Karhunen, K. Electrical Resistance Tomography for Assessment of Cracks Lithium compounds Investigation of Alkali-Silica Reaction Inhibited by in Concrete (107-M60) Sept.-Oct. 2010 A ee New Lithium Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; Khayat, K. H. Tang, M.; Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010 —Inclined Plane Test to Evaluate Structural Buildup at Rest of Self- Liu, L. Calcium Hydroxide Formation in Thin Cement Paste Exposed to Air Consolidating Concrete (107-M59) Sept.-Oct. 2010 .. sae (107-M42) July-Aug. 2010 . —Performance of Cast-in-Place Self-Consolidating Concrete Made with Liu, Q. Creep Behavior of High-Strength Concrete with Polypropy.ene Various Types of Viscosity-Enhancing Admixtures (107-M47) July-Aug. Fibers at Elevated Temperatures (107-M22) Mar.-Apr. 2010 2010 403 Liu, Z. Temperature Stability of Compressive Strength of Cement Asphalt —Shrinkage of Precast, Prestnsed Self-Consolidating Concrete (107-M27) Mortar (107-M04) Jan.-Feb. 2010. . May-June 2010 .... ; 231 Long, W. J. Shrinkage of Precast, Prestressed Self-Consolidating Kheder, G. F. New Method for Proportioning Self.( consolidating Concrete Concrete (107-M27) May-June 2010 Based on Compressive Strength Requirements (107-M56) Sept.-Oct. Longitudinal wave Numerical Simulation of Stress Waves on Surface of 2010. ary .. 490 Strongly Heterogeneous Media (107-M53) Aggelis, D. G., Sept.-Oct. Khoe, C. Messusement of Oxygen Permeability ” Reeny Poly mers 2010 (107-M18) Mar.-Apr. 2010....... ae . 138 Long-term durability Ravissumentel Effects on Mechanical Properties of Kim, J. H. Intrinsic Model to Predict Formwork Pressure (107-M03) Wet Lay-Up Fiber-Reinforced Polymer (107-M31) Saadatmanesh, H.: Jan.-Feb. 2010. ala See Tavakkolizadeh, M.; and Mostofinejad, D., May-June 2010 ........ 267 Kim, K. H. Modeling Mechanical Behavior of f Reinforced Co ncrete due to Loulizi, A. Compacted Sand Concrete in Pavement Construction: An Corrosion of Steel Bar (107-M14) Mar.-Apr. 2010 . Economical and Environmental Solution (107-M24) Mar.-Apr. 2010 . . . 195 Kim, S.-H. Influence of Chemistry of Chloride lons in Cement Matrix on Lu, G. Investigation into Yield Behavior of Fresh Cement Paste: Model and Corrosion of Steel (107-M38) July-Aug. 2010. Experiment (107-M02) Jan.-Feb. 2010 654 ACI Materials Journal/March-April 2011 Mo, L. Potential Approach to Evaluating Soundness of Concrete Containing MgO-Based Expansive Agent (107-M13) Mar.-Apr. 2010 Mo, X. Investigation of Alkali-Silica Reaction Inhibited by New Lithium Ma, B.-G. Design and Research on Gradient Structure Concrete Based on Compound (107-M06) Jan.-Feb. 2010 Volumetric Stabilization (107-M69) Nov.-Dec. 2010 Mobasher, B. Correlation of Reaction Products and Expansion Potential Macrosynthetic fibers Influence of Fiber Type on Creep Deformation of in Alkali-Silica Reaction for Blended Cement Materials (107-M44) July-Aug. 2010 Cracked Fiber-Reinforced Shotcrete Panels (107-M54) Bernard, E. S., Sept.-Oct. 2010 Modeling Measurement of Oxygen Permeability of Epoxy Polymers Maekawa, K. Bidirectional Multiple Cracking Tests on High-Performance (107-M18) Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr. 2010 Fiber-Reinforced Cementitious Composite Plates (107-M51) Sept.-Oct. Modeling Mechanical Behavior of Reinforced Concrete due to Malhotra, S. N. Corrosion Protection of Fiber-Reinforced Polymer- Corrosion of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.; Wrapped Reinforced Concrete (107-M40) July-Aug. 2010 and Oh, B. H., Mar.-Apr. 2010 Mancio, M. Instantaneous In-Situ Determination of Water-Cement Ratio of Models for Chloride Diffusion Coefficients of Concretes in Tidal Zone Fresh Concrete (107-M66) Nov.-Dec. 2010 (107-M01) Bermidez, M. A., and Alaejos, P., Jan.-Feb. 2010 Modulus of elasticity Artificial Neural Network Modeling of Early-Age Marine environment Models for Chloride Diffusion Coefficients of Dynamic Young’s Modulus of Normal Concrete (107-M33) Venkiteela, G.; Concretes in Tidal Zone (107-M01) Bermiidez, M. A., and Alaejos, P., NG A iret Sie ate wiser bce wid rn Rowena dcan le Kaen cet eeatar e 3 Gregori, A.; Sun, Z.; and Shah, S. P., May-June 2010 Moisture loss Early-Age Shrinkage Strains Versus Depth of Low Water- Masonry structures Polyvinyl Alcohol Fiber-Reinforced Mortars for Masonry Applications (107-M09) Skourup, B. N., and Erdogmus, E., Cement Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.; and Myint-Lay, K., May-June 2010 Jan.-Feb. 2010 Momoki, S. Characterization of Deep Surface-Opening Cracks in Mass loss Corrosion Protection of Fiber-Reinforced Polymer-Wrapped Concrete: Feasibility of Impact-Generated Rayleigh-Waves (107-M36) Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S. N., RE SINS wa'siscd dan scestnssavenvackedewtpaaeeheainy 305 PN Ns 5 Saran ane arr seohed eet cae tw nin pee ane 349 Monteiro, P. J. M. Maximum aggregate size Size and Wall Effects on Compressive Strength of Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. —Electrical Resistance Tomography for Assessment of Cracks in Concrete BE cds a cite pada uke ea weed hiked Netix hie aba ceh ba keen 372 (107-M60) Sept.-Oct. 2010 —TInstantaneous In-Situ Determination of Water-Cement Ratio of Fresh Measurement of Oxygen Permeability of Epoxy Polymers (107-M18) Concrete (107-M66) Nov.-Dec. 2010 Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr. Moore, J. R. Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh Concrete (107-M66) Nov.-Dec. 2010 Mechanical properties Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., Morris, P. H. Performance of Permeability-Reducing Admixtures in Nov.-Dec. 2010 Marine Concrete Structures (107-M34) May-June 2010 Meddah, M. S. Effect of Curing Methods on Autogenous Shrinkage and Mortar Self-Induced Stress of High-Performance Concrete (107-M10) Jan.-Feb. —Analysis of Mortar Long-Term Strength with Supplementary Cementitious Materials Cured at Different Temperatures (107-M37) Mehta, P. K. Salt Weathering of Concrete by Sodium Carbonate and Sodium Ezziane, K.; Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug. Chloride (107-M30) May-June 2010 —Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of Mercury porosimetry Effect of Age and Water-Cement Ratio on Size and Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010 Dispersion of Pores in Ordinary Portland Cement Paste (107-M19) Kondraivendhan, B., and Bhattacharjee, B., Mar.-Apr. 2010 —Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate on Shrinkage Cracking of Mortars (107-M61) Topgu, I. B., and Bilir, T., Method New Method for Proportioning Self-Consolidating Concrete Based Nov.-Dec. 2010 on Compressive Strength Requirements (107-M56) Kheder, G. F., and Al Jadiri, R. S., Sept.-Oct. 2010 Mostofinejad, D. Environmental Effects on Mechanical Properties of Wet Lay-Up Fiber-Reinforced Polymer (107-M31) May-June 2010 Methylene blue Detection of Aggregate Clay Coatings and Impacts on Concrete (107-M45) Mufioz, J. F.; Tejedor, M. I.; Anderson, M. A.; and Mukherjee, A. Corrosion Protection of Fiber-Reinforced Polymer- Cramer, S. M., July-Aug. 2010 Wrapped Reinforced Concrete (107-M40) July-Aug. 2010 Multiple cracks Bidirectional Multiple Cracking Tests on High-Performance MgO-based expansive agent Potential Approach to Evaluating Soundness of Concrete Containing MgO-Based Expansive Agent (107-M13) Mo, L.; Fiber-Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.; Deng, M.; and Tang, M., Mar.-Apr. 2010 Nagai, K.; and Maekawa, K., Sept.-Oct. 2010 Mujfioz, J. F. Detection of Aggregate Clay Coatings and Impacts on Microfines Detection of Aggregate Clay Coatings and Impacts on Concrete (107-M45) Mufioz, J. F.; Tejedor, M. L.; Anderson, M. A.; and Cramer, S. M., Concrete (107-M45) July-Aug. 2010 July-Aug. 2010 Muthusamy, S. Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding (107-M68) Nov.-Dec. 2010 Microstructure Myint-Lay, K. Early-Age Shrinkage Strains Versus Depth of Low Water- —Assessing Mechanical Properties and Microstructure of Fire-Damaged Cement Ratio Mortar Prisms (107-M25) May-June 2010 Engineered Cementitious Composites (107-M35) Sahmaran, M.; Lachemi, M.; and Li, V. C., May-June 2010 —Correlation of Reaction Products and Expansion Potential in Alkali- Silica Reaction for Blended Cement Materials (107-M44) Bonakdar, A.; Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug. 2010 ........ 380 Nagai, K. Bidirectional Multiple Cracking Tests on High-Performance Mineral admixtures Models for Chloride Diffusion Coefficients of Fiber-Reinforced Cementitious Composite Plates (107-M51) Sept.-Oct. Concretes in Tidal Zone (107-M01) Bermudez, M. A., and Alaejos, P., Jan.-Feb. 2010 Natural pozzolan Analysis of Mortar Long-Term Strength with Supplementary Mixture proportioning Cementitious Materials Cured at Different Temperatures (107-M37) —New Method for Proportioning Self-Consolidating Concrete Based Ezziane, K.; Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug. on Compressive Strength Requirements (107-M56) Kheder, G. F., and Al Jadiri, R. S., Sept.-Oct. 2010 Neff, M. Salt Weathering of Concrete by Sodium Carbonate and Sodium —New Methodology to Proportion Self-Consolidating Concrete with High- Chloride (107-M30) May-June 2010 Volume Fly Ash (107-M26) Chowdhury, S., and Basu, P. C., May-June NeithN.a Plalnara Itmaghe-B,ase d Reconsotf Prervuioucs tConicreote nPo re Structure and Permeability Prediction (107-M48) July-Aug. 2010 ACI Materials Journal/March-April 2011 655 Neji, J. Compacted Sand Concrete in Pavement Construction: An Economical Ozkul, M. H. Size and Wall Effects on Compressive Strength of Concretes and Environmental Solution (107-M24) Mar.-Apr. 2010. . (107-M43) July-Aug. 2010 Neptune, A. I. Effect of Aggregate Size and Gradation on Pervious Concrete Mixtures (107-M71) Nov.-Dec. 2010 sat Wie ak . 625 New Method for Proportioning Self-Consolidating Concrete Based on Compressive Strength Requirements (|07-M56) Kheder, G. F., and Passive protection Corrosion Protection of Fiber-Reinforced Polymer- Al Jadiri, R. S., Sept.-Oct. 2010 .... : _ 490 Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and New Methodology to Proportion Self-C onsolidating Concrete with Malhotra, S. N., July-Aug. 2010 High-Volume Fly Ash (107-M26) Chowdhury, S., and Basu, P. C., Patodi, S. C. Interface Tailoring of Polyester-Type Fiber in Engineered May-June 2010 ..... re: Cementitious Composite Matrix against Pullout (107-M15) Mar.-Apr. New Viscoelastic Model for Early-- Age Concrete Based on Mennuved 2010. Strains and Stresses (107-M28) Choi, S. C., and Oh, B. H., May-June Pavate, T. V. Inclined Plane Test to Evaluate Structural Buildup at Rest of 2010 ica Self-Consolidating Concrete (107-M59) Sept.-Oct. 2010 .......... 515 Nogueira, C. L. Wavelet Analysis of Ultrasonic Pulses in ce ment-Based Pavements Compacted Sand Concrete in Pavement Construction: An Materials (107-M29) May-June 2010 oceelsaacee Economical and Environmental Solution (107-M24) El Euch Khay, S.; Nokken, M. R. Expansion of MgO in Cement Pastes Measured by Different Neji, J.; and Loulizi, A., Mar.-Apr. 2010 Methods (107-M12) Jan.-Feb. 2010 80 Peng, T. Corrosion Process of Steel Bar in Concrete in Full Lifetime Nondestructive evaluation Inspection of Concrete Us ing Air-Coupled (107-M63) Nov.-Dec. 2010. Pe eee ee Ultrasonic Pulse Velocity (107-M20) Cetrangolo, G. P., and Popovics,J . S., Percolation Triple Percolation in Concrete Reinforced with Carbon Fiber Mar.-Apr. 2010 . 155 (107-M46) Baeza, F. J.; Chung, D. D. L.; Zornoza, E.; Andién, L. G.; and Nondestructive testing Re Wo UE I 9:8 ced Aicinw Gama daldehice cw team we en 396 Characterization of Deep Surface-Opening Cracks in Concrete: Feasibility Performance Investigation of Alkali-Silica Reaction Inhibited by New of Impact-Generated Rayleigh-Waves (107-M36) Chai, H. K.; Momoki, S.; Lithium Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; Aggelis, D. G.; and Shiotani, T., May-June 2010 ee Tang, M.; Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010 .......... 37 Electrical Resistance Tomography for Assessment of Cracks in Concrete Performance of Cast-in-Place Self-Consolidating Concrete Made with (107-M60) Karhunen, K.; Seppanen, A.; Lehikoinen, A.; Blunt,J .;K aipio, J. P.; Various Types of Viscosity-Enhancing Admixtures (107-M47) and Monteiro, P. J. M., Sept.-Oct. 2010 ‘ a . 523 Khayat, K. H.; Hwang, S.-D.; and Belaid, K., July-Aug. 2010 Inspection of Concrete Using Air-Coupled Ultrasonic Pulse Velocity Performance of Permeability-Reducing Admixtures in Marine (107-M20) Cetrangolo, G. P., and Popovics, J. S., Mar.-Apr. 2010 155 Concrete Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Morris, P. H.; Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh and Carse, A. H., May-June 2010 Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.; Periclase Expansion of MgO in Cement Pastes Measured by Different and Glaser, S. D., Nov.-Dec. 2010 586 Methods (107-M12) Nokken, M. R., Jan.-Feb. 2010 Numerical Simulation of Stress Waves on Surface of Strongly Permeability Heterogeneous Media (107-M53) Aggelis, D. G., Sept.-Oct. 2010 469 —Effect of Aggregate Size and Gradation on Pervious Concrete Mixtures Suitability of Various Measurement Techniques for Assessing Corrosion (107-M71) Neptune, A. L., and Putman, B. J., Nov.-Dec. 2010... .. . 625 in Cracked Concrete (107-M55) Otieno, M. B.; Alexander, M. G.; and —Measurement of Oxygen Permeability of Epoxy Polymers (107-M18) Beushausen, H. D., Sept.-Oct. 2010 er Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr. Wavelet Analysis of Ultrasonic Pulses in Cement- Based Materials 2010. (107-M29) Nogueira,C . L., May-June 2010 : 248 Stee Image-Based Rescuntention of Pervious Concrete Pore Structure Nonstress cylinder Thermal Strain and Drying Shrinkage of Concrete and Permeability Prediction (107-M48) Sumanasooriya, M. S.; Bentz, D. P.; Structures in the Field (107-M57) Choi, S., and Won, M. C., Sept.-Oct and Neithalath, N., July-Aug. 2010. . . 2010 498 Permeability-reducing admixture Performance of Permeability-Reducing Numerical Simulation of Stress Waves on Surface of Strongly Admixtures in Marine Concrete Structures (107-M34) Dao, V. T. N.; Heterogeneous Media (|(07-M53) Aggelis, D. G., Sept.-Oct. 2010 469 Dux, P. F.; Morris, P. H.; and Carse, A. H., May-June 2010 ........ 291 Pervious concrete Oo —Calcium Hydroxide Formation in Thin Cement Paste Exposed to Air (107-M42) Haselbach, L. M., and Liu, L., July-Aug. 2010 ........ . 365 Oh, B. H. —Effect of Aggregate Size and Gradation on Pervious Concrete Mixtures Modeling Mechanical Behavior of Reinforced Concrete due to Corrosion (107-M71) Neptune, A. I., and Putman, B. J., Nov.-Dec. 2010 of Steel Bar (107-M14) Mar.-Apr. 2010 ; 106 —Planar Image-Based Reconstruction of Pervious Concrete Pore Structure New Viscoelastic Model for Early-Age Concrete Based on Measured and Permeability Prediction (107-M48) Sumanasooriya, M. S.; Bentz, D. P.; Strains and Stresses (107-M28) May-June 2010 239 and Neithalath, N., July-Aug. 2010. Omran, A. F. Inclined Plane Test to Evaluate Structural Buildup at Rest of Phase velocity Wavelet Analysis of Ultrasonic Pulses in Cement-Based Self-Consolidating Concrete (107-M59) Sept.-Oct. 2010 515 Materials (107-M29) Nogueira, C. L., May-June 2010 ............ 248 O'Neill, R. Salt Weathering of Concrete by Sodium Carbonate and Sodium Phithaksounthone, A. Synergistic Effect between Glass Frit and Blast- Chloride (107-M30) May-June 2010 v<70aee Furnace Slag (107-M11) Jan.-Feb. 2010 Ong, K. C. G. Early-Age Shrinkage Strains Versus Depth of Low Water- Phung, Q. T. Intrinsic Model to Predict Formwork Pressure (107- M03) Cement Ratio Mortar Prisms (107-M25) May-June 2010 213 Jan.-Feb. 2010 Finan & Fh occa aaa aa aiare hater 20 Opening-sliding Bidirectional Multiple Cracking Tests on High-Performance Physical salt attack Salt W wuthe ring of Concrete by Sodium Carbonate and Fiber-Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.; Sodium Chloride (107-M30) Haynes, H.; O'Neill, R.; Neff, M.; and Nagai, K.; and Maekawa, K., Sept.-Oct. 2010 , exacaOe FsWig EN E DU sais ccngcapenaceataceesudvedevanee Orthogonal Hybrid Rotating/Fixed-Crack Model for High-Performance Planar Image-Based Reconstruction of Pervious Concrete Pore Structure Fiber-Reinforced Cementitious Composites (107-M64) Hung, C.-C., and and Permeability Prediction (| 07-M48) Sumanasooriya, M. S.; Bentz, D. P.; El-Tawil, S., Nov.-Dec. 2010 : ; .. 568 and Neithalath, N., July-Aug. 2010 Otieno, M. B. Suitability of Various Measurement Techniques for Plane stress Hybrid Rotating/Fixed-Crack Model for High-Performance Assessing Corrosion in Cracked Concrete (107-M55) Sept.-Oct. Fiber-Reinforced Cementitious Composites (107-M64) Hung, C.-C., and 2010 Javan . 481 a SE: CD's 6 3 ova nwaekehennmadaliesniiem enae 568 Oxygen Measurement of Oxygen Permeability of Rpeny Polymers Plastic viscosity Performance of Cast-in-Place Self-Consolidating Concrete (107-M18) Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Made with Various Types of Viscosity-Enhancing Admixtures (107-M47) Mar.-Apr. 2010 Khayat, K. H.; Hwang, S.-D.; and Belaid, K., July-Aug. 2010 656 ACI Materials Journal/March-April 2011

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.